BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P01_F_H22 (652 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB267886-1|BAF46356.1| 567|Apis mellifera ecdysteroid receptor ... 24 1.5 AB095514-1|BAC76336.1| 72|Apis mellifera ecdyson receptor prot... 24 1.5 AJ968562-1|CAI91546.1| 998|Apis mellifera protein ( Apis mellif... 23 2.6 >AB267886-1|BAF46356.1| 567|Apis mellifera ecdysteroid receptor A isoform protein. Length = 567 Score = 23.8 bits (49), Expect = 1.5 Identities = 10/24 (41%), Positives = 15/24 (62%) Frame = -3 Query: 386 EGCTVFTKQSVTKNGKGMFKWLSN 315 EGC F ++S+TKN K+ +N Sbjct: 205 EGCKGFFRRSITKNAVYQCKYGNN 228 >AB095514-1|BAC76336.1| 72|Apis mellifera ecdyson receptor protein. Length = 72 Score = 23.8 bits (49), Expect = 1.5 Identities = 10/24 (41%), Positives = 15/24 (62%) Frame = -3 Query: 386 EGCTVFTKQSVTKNGKGMFKWLSN 315 EGC F ++S+TKN K+ +N Sbjct: 2 EGCKGFFRRSITKNAVYQCKYGNN 25 >AJ968562-1|CAI91546.1| 998|Apis mellifera protein ( Apis mellifera ORF for hypotheticalprotein. ). Length = 998 Score = 23.0 bits (47), Expect = 2.6 Identities = 10/30 (33%), Positives = 16/30 (53%) Frame = +1 Query: 556 SILTYLLVCYFFCTSMDIFICLVSFLFLIY 645 S +Y+ V TSM +IC + +L+Y Sbjct: 639 SYYSYIGVLTLVATSMPTYICYLGKAYLMY 668 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 162,840 Number of Sequences: 438 Number of extensions: 3080 Number of successful extensions: 4 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 19682733 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -