BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P01_F_H20 (508 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC31A2.16 |gef2||RhoGEF Gef2|Schizosaccharomyces pombe|chr 1||... 28 0.92 SPBC4F6.16c |ero11||ER oxidoreductin Ero1a|Schizosaccharomyces p... 25 8.6 >SPAC31A2.16 |gef2||RhoGEF Gef2|Schizosaccharomyces pombe|chr 1|||Manual Length = 1101 Score = 27.9 bits (59), Expect = 0.92 Identities = 15/39 (38%), Positives = 23/39 (58%) Frame = +2 Query: 389 KMTSHAY*NNIEKINQEYSTKKLNPMIGLLLNSSFISQV 505 ++ SH N I Q+Y + +N G+LL+SSFI Q+ Sbjct: 839 ELLSHYPPNIIYATFQKYLSSFINRKFGVLLSSSFIQQL 877 >SPBC4F6.16c |ero11||ER oxidoreductin Ero1a|Schizosaccharomyces pombe|chr 2|||Manual Length = 467 Score = 24.6 bits (51), Expect = 8.6 Identities = 11/29 (37%), Positives = 17/29 (58%) Frame = -2 Query: 498 LINEELRSKPIXGLSFFVEYSWLIFSILF 412 LI + RS L+FF++ +W +F LF Sbjct: 430 LIYKTYRSPSKEILAFFIDQTWYLFYALF 458 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,889,985 Number of Sequences: 5004 Number of extensions: 34815 Number of successful extensions: 79 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 78 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 79 length of database: 2,362,478 effective HSP length: 68 effective length of database: 2,022,206 effective search space used: 202220600 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -