BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P01_F_H20 (508 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g10010.1 68414.m01129 amino acid permease, putative similar t... 27 9.6 >At1g10010.1 68414.m01129 amino acid permease, putative similar to amino acid permease I GI:22641 from [Arabidopsis thaliana]; GC splice site at position 1256 is predicted from alignment and not confirmed experimentally Length = 475 Score = 26.6 bits (56), Expect = 9.6 Identities = 11/33 (33%), Positives = 17/33 (51%) Frame = -1 Query: 250 VLWXTCYFVLISLVHNAFSLVSIQLKYIGMYLF 152 ++W TCY VL + V F + L +G + F Sbjct: 379 LVWRTCYVVLTTFVAMIFPFFNAILGLLGAFAF 411 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,114,113 Number of Sequences: 28952 Number of extensions: 157092 Number of successful extensions: 278 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 276 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 278 length of database: 12,070,560 effective HSP length: 76 effective length of database: 9,870,208 effective search space used: 908059136 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -