BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P01_F_H18 (651 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292371-1|CAL23183.2| 350|Tribolium castaneum gustatory recept... 23 2.2 AY337337-2|AAP94193.1| 491|Tribolium castaneum cytochrome P450 ... 21 8.8 AF251548-1|AAF70178.1| 491|Tribolium castaneum cytochrome P450 ... 21 8.8 >AM292371-1|CAL23183.2| 350|Tribolium castaneum gustatory receptor candidate 50 protein. Length = 350 Score = 23.0 bits (47), Expect = 2.2 Identities = 12/32 (37%), Positives = 18/32 (56%) Frame = +3 Query: 201 IFFLKQ*RINKKFGYFYQTINLMHVFCGTNVS 296 IFF K RI+K+FG +IN + N++ Sbjct: 98 IFFDKIQRIDKQFGLLGYSINYRRISIFVNLA 129 >AY337337-2|AAP94193.1| 491|Tribolium castaneum cytochrome P450 monooxygenase protein. Length = 491 Score = 21.0 bits (42), Expect = 8.8 Identities = 8/14 (57%), Positives = 11/14 (78%) Frame = +1 Query: 403 ILSPTQVHLLLTDT 444 +L+P V L+LTDT Sbjct: 82 LLNPEDVELVLTDT 95 >AF251548-1|AAF70178.1| 491|Tribolium castaneum cytochrome P450 monooxigenase CYP4Q4 protein. Length = 491 Score = 21.0 bits (42), Expect = 8.8 Identities = 8/14 (57%), Positives = 11/14 (78%) Frame = +1 Query: 403 ILSPTQVHLLLTDT 444 +L+P V L+LTDT Sbjct: 82 LLNPEDVELVLTDT 95 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 138,879 Number of Sequences: 336 Number of extensions: 2769 Number of successful extensions: 5 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 16760905 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -