BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P01_F_H18 (651 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 06_01_0484 + 3439365-3439474,3439574-3439699,3439700-3439851,344... 29 2.4 >06_01_0484 + 3439365-3439474,3439574-3439699,3439700-3439851, 3440129-3440238,3440872-3440957,3441463-3441573, 3441679-3441799 Length = 271 Score = 29.5 bits (63), Expect = 2.4 Identities = 13/41 (31%), Positives = 23/41 (56%) Frame = -1 Query: 183 HFNFFQTIYSGLLRHHKSC*GNKYSKLLNSKVGYFGCPIVA 61 H ++ + G+L H++ ++ K+LN V YFG P+ A Sbjct: 76 HICRYEDRFDGVLLAHEATVESEQGKILNGLVPYFGVPVHA 116 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,701,831 Number of Sequences: 37544 Number of extensions: 225006 Number of successful extensions: 237 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 232 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 237 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1620349964 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -