BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P01_F_H18 (651 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U23454-2|AAC46519.2| 368|Caenorhabditis elegans Hypothetical pr... 28 6.6 AL023847-6|CAA19552.1| 297|Caenorhabditis elegans Hypothetical ... 28 6.6 >U23454-2|AAC46519.2| 368|Caenorhabditis elegans Hypothetical protein C10A4.5 protein. Length = 368 Score = 27.9 bits (59), Expect = 6.6 Identities = 10/32 (31%), Positives = 18/32 (56%) Frame = +3 Query: 114 IYYLNRTCDVLKDPSKWFEKN*SVLIFELIFF 209 +YYLN+ V + +W E N + +F ++ F Sbjct: 127 VYYLNKQSHVCLNVPEWLEHNMEITVFLVVAF 158 >AL023847-6|CAA19552.1| 297|Caenorhabditis elegans Hypothetical protein Y57A10C.10 protein. Length = 297 Score = 27.9 bits (59), Expect = 6.6 Identities = 12/36 (33%), Positives = 20/36 (55%) Frame = -1 Query: 114 YSKLLNSKVGYFGCPIVALARSVILGYVDVVLVQLT 7 Y +L K+ + C + + SV+LG++D VL T Sbjct: 65 YFPILYRKMDHVDCSNLLMLISVLLGFIDTVLAMCT 100 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,719,048 Number of Sequences: 27780 Number of extensions: 229894 Number of successful extensions: 361 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 359 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 361 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1444744186 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -