BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P01_F_H14 (653 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBP8B7.24c |atg8||autophagy associated protein Atg8 |Schizosacc... 158 7e-40 SPBC557.05 |||arrestin|Schizosaccharomyces pombe|chr 2|||Manual 25 9.5 SPBC18H10.04c |sce3|tif48|translation initiation factor eIF4B|Sc... 25 9.5 >SPBP8B7.24c |atg8||autophagy associated protein Atg8 |Schizosaccharomyces pombe|chr 2|||Manual Length = 121 Score = 158 bits (383), Expect = 7e-40 Identities = 68/117 (58%), Positives = 90/117 (76%) Frame = +3 Query: 105 SNYKEEHSFEKRKAEGEKIRRKYPDRVPVIVEKAPKARLGDLDKKKYLVPSDLTVGQFYF 284 S +K++ SFEKRK E ++IR KYPDR+PVI EK K+ + +DKKKYLVPSDLTVGQF + Sbjct: 3 SQFKDDFSFEKRKTESQRIREKYPDRIPVICEKVDKSDIAAIDKKKYLVPSDLTVGQFVY 62 Query: 285 LIRKRIHLRPEDALFFFVNNVIPPTSATMGSLYQEHHDEDFFLYIAFSDENVYGN*F 455 +IRKRI L PE A+F F++ ++PPT+A M ++Y+EH ED FLYI +S EN +G F Sbjct: 63 VIRKRIKLSPEKAIFIFIDEILPPTAALMSTIYEEHKSEDGFLYITYSGENTFGTVF 119 >SPBC557.05 |||arrestin|Schizosaccharomyces pombe|chr 2|||Manual Length = 433 Score = 25.0 bits (52), Expect = 9.5 Identities = 11/21 (52%), Positives = 16/21 (76%), Gaps = 1/21 (4%) Frame = -1 Query: 479 NYLKVNNLELISIDIF-VGKC 420 N KVN ++LISI++F +G C Sbjct: 71 NKSKVNEIQLISIEVFIIGIC 91 >SPBC18H10.04c |sce3|tif48|translation initiation factor eIF4B|Schizosaccharomyces pombe|chr 2|||Manual Length = 388 Score = 25.0 bits (52), Expect = 9.5 Identities = 17/52 (32%), Positives = 23/52 (44%) Frame = +3 Query: 108 NYKEEHSFEKRKAEGEKIRRKYPDRVPVIVEKAPKARLGDLDKKKYLVPSDL 263 N E S RK +K + D+ I EK RLGD +KK S++ Sbjct: 306 NANRERS-TSRKPSADKAEKT--DKTDAIAEKVSDIRLGDGEKKSSETDSEV 354 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,501,965 Number of Sequences: 5004 Number of extensions: 51901 Number of successful extensions: 115 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 113 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 115 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 295793106 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -