BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P01_F_H14 (653 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AB090815-2|BAC57906.1| 973|Anopheles gambiae reverse transcript... 25 2.1 EF990671-1|ABS30732.1| 1256|Anopheles gambiae voltage-gated calc... 24 3.7 AY334011-1|AAR01136.1| 188|Anopheles gambiae beta-tubulin protein. 24 3.7 AY334010-1|AAR01135.1| 188|Anopheles gambiae beta-tubulin protein. 24 3.7 AY334009-1|AAR01134.1| 188|Anopheles gambiae beta-tubulin protein. 24 3.7 AY334008-1|AAR01133.1| 188|Anopheles gambiae beta-tubulin protein. 24 3.7 AJ439353-3|CAD27925.1| 1200|Anopheles gambiae putative TPR-conta... 23 6.4 AJ439353-10|CAD27932.1| 3325|Anopheles gambiae F25C8.3 protein p... 23 8.4 >AB090815-2|BAC57906.1| 973|Anopheles gambiae reverse transcriptase protein. Length = 973 Score = 25.0 bits (52), Expect = 2.1 Identities = 9/15 (60%), Positives = 13/15 (86%) Frame = +2 Query: 458 NYSLSNSFTLSDHMV 502 N+ +SN++TLSDH V Sbjct: 183 NWRVSNAYTLSDHRV 197 >EF990671-1|ABS30732.1| 1256|Anopheles gambiae voltage-gated calcium channel alpha2-delta subunit 1 protein. Length = 1256 Score = 24.2 bits (50), Expect = 3.7 Identities = 10/25 (40%), Positives = 16/25 (64%) Frame = +3 Query: 363 ATMGSLYQEHHDEDFFLYIAFSDEN 437 AT ++ D+DFF I+FSD++ Sbjct: 290 ATASAILDTLGDDDFFNLISFSDQS 314 >AY334011-1|AAR01136.1| 188|Anopheles gambiae beta-tubulin protein. Length = 188 Score = 24.2 bits (50), Expect = 3.7 Identities = 10/30 (33%), Positives = 15/30 (50%) Frame = +3 Query: 156 KIRRKYPDRVPVIVEKAPKARLGDLDKKKY 245 KIR +YPDR+ P ++ D + Y Sbjct: 50 KIREEYPDRIMNTYSVVPSPKVSDTVVEPY 79 >AY334010-1|AAR01135.1| 188|Anopheles gambiae beta-tubulin protein. Length = 188 Score = 24.2 bits (50), Expect = 3.7 Identities = 10/30 (33%), Positives = 15/30 (50%) Frame = +3 Query: 156 KIRRKYPDRVPVIVEKAPKARLGDLDKKKY 245 KIR +YPDR+ P ++ D + Y Sbjct: 50 KIREEYPDRIMNTYSVVPSPKVSDTVVEPY 79 >AY334009-1|AAR01134.1| 188|Anopheles gambiae beta-tubulin protein. Length = 188 Score = 24.2 bits (50), Expect = 3.7 Identities = 10/30 (33%), Positives = 15/30 (50%) Frame = +3 Query: 156 KIRRKYPDRVPVIVEKAPKARLGDLDKKKY 245 KIR +YPDR+ P ++ D + Y Sbjct: 50 KIREEYPDRIMNTYSVVPSPKVSDTVVEPY 79 >AY334008-1|AAR01133.1| 188|Anopheles gambiae beta-tubulin protein. Length = 188 Score = 24.2 bits (50), Expect = 3.7 Identities = 10/30 (33%), Positives = 15/30 (50%) Frame = +3 Query: 156 KIRRKYPDRVPVIVEKAPKARLGDLDKKKY 245 KIR +YPDR+ P ++ D + Y Sbjct: 50 KIREEYPDRIMNTYSVVPSPKVSDTVVEPY 79 >AJ439353-3|CAD27925.1| 1200|Anopheles gambiae putative TPR-containing phosphoprotein protein. Length = 1200 Score = 23.4 bits (48), Expect = 6.4 Identities = 11/20 (55%), Positives = 14/20 (70%) Frame = -3 Query: 333 RRKVRLQAAGEYVSGSRSRT 274 R + R Q+AG SGSRSR+ Sbjct: 1131 RSRSRSQSAGSRKSGSRSRS 1150 >AJ439353-10|CAD27932.1| 3325|Anopheles gambiae F25C8.3 protein protein. Length = 3325 Score = 23.0 bits (47), Expect = 8.4 Identities = 10/24 (41%), Positives = 13/24 (54%) Frame = +2 Query: 302 SPAA*RRTFLLREQCHSTHICNNG 373 +P R FL+ E H H+CN G Sbjct: 1110 APIVARAAFLI-ECAHFVHLCNRG 1132 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 611,947 Number of Sequences: 2352 Number of extensions: 12031 Number of successful extensions: 29 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 28 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 29 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 64814025 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -