BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P01_F_H11 (641 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value X91618-1|CAA62821.1| 524|Tribolium castaneum hunchback protein. 21 6.5 AY884065-1|AAX84206.1| 697|Tribolium castaneum laccase 1 protein. 21 6.5 AM292326-1|CAL23138.2| 522|Tribolium castaneum gustatory recept... 21 6.5 >X91618-1|CAA62821.1| 524|Tribolium castaneum hunchback protein. Length = 524 Score = 21.4 bits (43), Expect = 6.5 Identities = 12/42 (28%), Positives = 20/42 (47%) Frame = +1 Query: 244 SAT*YTTMPSQYEEERVWDGQNHNNQYEEXGNEHVIENPAXG 369 S T ++ + EE + + ++NN +E GN N A G Sbjct: 440 STTVFSNVEVVQEEAKKEESDSNNNNNKEEGNSCQYCNIAFG 481 >AY884065-1|AAX84206.1| 697|Tribolium castaneum laccase 1 protein. Length = 697 Score = 21.4 bits (43), Expect = 6.5 Identities = 6/13 (46%), Positives = 10/13 (76%) Frame = -2 Query: 313 YDSDHPIHVLPHT 275 YD++HP H+ H+ Sbjct: 528 YDANHPFHLHGHS 540 >AM292326-1|CAL23138.2| 522|Tribolium castaneum gustatory receptor candidate 5 protein. Length = 522 Score = 21.4 bits (43), Expect = 6.5 Identities = 12/25 (48%), Positives = 15/25 (60%) Frame = +2 Query: 368 VLNECLEKFKTPXYIMEPXIFGQLK 442 VL L+K+KT Y+M GQLK Sbjct: 164 VLEMLLQKYKTVTYVMT----GQLK 184 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 139,577 Number of Sequences: 336 Number of extensions: 2739 Number of successful extensions: 3 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 16448590 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -