BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P01_F_H11 (641 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_42015| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 3e-05 SB_10214| Best HMM Match : VWA (HMM E-Value=1.30321e-43) 28 7.4 >SB_42015| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 197 Score = 45.6 bits (103), Expect = 3e-05 Identities = 20/41 (48%), Positives = 26/41 (63%) Frame = +3 Query: 519 WPTY*LNGLSLGGVKVSEVQAMVENHLXDMILKTFDPKKAD 641 W LS G V +V+ +VENHL D+I+K FDPK+AD Sbjct: 132 WDAPCSGALSAAGSNVHDVEQLVENHLKDLIIKHFDPKRAD 172 >SB_10214| Best HMM Match : VWA (HMM E-Value=1.30321e-43) Length = 821 Score = 27.9 bits (59), Expect = 7.4 Identities = 11/25 (44%), Positives = 17/25 (68%) Frame = +2 Query: 11 CLFMF*KKRFFSYLMNIXCFNFDNQ 85 C F+F + FF +L++ FN+DNQ Sbjct: 52 CCFLF-HENFFQFLVSHNIFNYDNQ 75 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,888,903 Number of Sequences: 59808 Number of extensions: 292218 Number of successful extensions: 381 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 359 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 381 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1620947750 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -