BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P01_F_H11 (641 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U39744-1|AAK18882.1| 471|Caenorhabditis elegans Hypothetical pr... 28 6.5 AF016681-6|AAB66175.2| 317|Caenorhabditis elegans Hypothetical ... 28 6.5 Z81552-4|CAB04488.2| 765|Caenorhabditis elegans Hypothetical pr... 27 8.6 U80029-9|AAB37588.1| 459|Caenorhabditis elegans Hypothetical pr... 27 8.6 >U39744-1|AAK18882.1| 471|Caenorhabditis elegans Hypothetical protein C03F11.1 protein. Length = 471 Score = 27.9 bits (59), Expect = 6.5 Identities = 15/48 (31%), Positives = 25/48 (52%) Frame = +2 Query: 383 LEKFKTPXYIMEPXIFGQLKRYFQAGGNPQQVIEQLSMNYNAVXXMAN 526 L F +I+ +F Q +RY +G NPQ ++ S+ + A+ M N Sbjct: 267 LTTFTFIFWIIMSWMFVQCERYGFSGKNPQSILYSNSLWFIAITFMLN 314 >AF016681-6|AAB66175.2| 317|Caenorhabditis elegans Hypothetical protein F22E5.11 protein. Length = 317 Score = 27.9 bits (59), Expect = 6.5 Identities = 15/45 (33%), Positives = 25/45 (55%), Gaps = 3/45 (6%) Frame = +2 Query: 29 KKRFFSYLMNIXCFNFDNQXP---QHHKFVVCLKLYVYLFRLIFI 154 K S L+N+ FD+Q P H KF++ + + + L +LIF+ Sbjct: 20 KDNIRSSLVNLKLL-FDSQEPPEFDHQKFIMSIVIMILLLKLIFL 63 >Z81552-4|CAB04488.2| 765|Caenorhabditis elegans Hypothetical protein F56G4.6 protein. Length = 765 Score = 27.5 bits (58), Expect = 8.6 Identities = 10/28 (35%), Positives = 20/28 (71%) Frame = -2 Query: 178 CFYSCLHGNKD*SEKVHVQL*TNNKFMM 95 C++S L K+ S +VH+Q+ N++F++ Sbjct: 160 CYFSVLLSLKNASSQVHIQIPANDEFVL 187 >U80029-9|AAB37588.1| 459|Caenorhabditis elegans Hypothetical protein T20D4.9 protein. Length = 459 Score = 27.5 bits (58), Expect = 8.6 Identities = 22/84 (26%), Positives = 38/84 (45%) Frame = -2 Query: 259 YIKLHSTSIKYNIY*I*SKQLLLLITMCFYSCLHGNKD*SEKVHVQL*TNNKFMMLRPLI 80 YIK + S K++ K + L +T FY+ L+ N + ++++ NKF L + Sbjct: 84 YIKKKNNSEKFSFMVETLKNVNLTLTNIFYNSLYANIEVLNQLNLPASEENKF--LHHIF 141 Query: 79 IKVKTXNIH*I*KKPFFSKHKQTF 8 +K I I F + K+ F Sbjct: 142 NMLKNNTIEEIWSSSFSDESKKEF 165 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,021,083 Number of Sequences: 27780 Number of extensions: 240042 Number of successful extensions: 375 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 368 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 375 length of database: 12,740,198 effective HSP length: 78 effective length of database: 10,573,358 effective search space used: 1427403330 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -