SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fe100P01_F_H08
         (629 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

DQ026039-1|AAY87898.1|  427|Apis mellifera nicotinic acetylcholi...    23   3.2  
AM076717-1|CAJ28210.1|  501|Apis mellifera serotonin receptor pr...    21   9.9  

>DQ026039-1|AAY87898.1|  427|Apis mellifera nicotinic acetylcholine
           receptor beta2subunit protein.
          Length = 427

 Score = 22.6 bits (46), Expect = 3.2
 Identities = 6/10 (60%), Positives = 9/10 (90%)
 Frame = -1

Query: 188 CLIDVTWKLP 159
           CL+DV W++P
Sbjct: 288 CLLDVQWRIP 297


>AM076717-1|CAJ28210.1|  501|Apis mellifera serotonin receptor
           protein.
          Length = 501

 Score = 21.0 bits (42), Expect = 9.9
 Identities = 10/34 (29%), Positives = 17/34 (50%)
 Frame = -2

Query: 556 NLFEHVDFWVDPLTSEHQTV*LCTQVFCKILLGH 455
           +L  H  F ++P   +HQ V +  Q+   +  GH
Sbjct: 242 HLEAHCYFDIEPTVQQHQPVTVNRQLNSDVQPGH 275


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 176,646
Number of Sequences: 438
Number of extensions: 3676
Number of successful extensions: 3
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 3
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 3
length of database: 146,343
effective HSP length: 55
effective length of database: 122,253
effective search space used: 18826962
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -