BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P01_F_H05 (653 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292380-1|CAL23192.2| 489|Tribolium castaneum gustatory recept... 23 1.7 AF225975-2|AAF74116.1| 302|Tribolium castaneum Tc-tailless prot... 22 3.8 AF219117-1|AAF71999.1| 406|Tribolium castaneum tailless ortholo... 22 3.8 >AM292380-1|CAL23192.2| 489|Tribolium castaneum gustatory receptor candidate 59 protein. Length = 489 Score = 23.4 bits (48), Expect = 1.7 Identities = 11/38 (28%), Positives = 19/38 (50%) Frame = +3 Query: 351 SLLVSLPLQIKHLLTWREVLKKLLYQLPVLMPPCLLWV 464 S L L ++KH+L W+ + ++ L LLW+ Sbjct: 109 SKLHKLDNKLKHMLIWKSYKRTQIFITCELFFVILLWI 146 >AF225975-2|AAF74116.1| 302|Tribolium castaneum Tc-tailless protein. Length = 302 Score = 22.2 bits (45), Expect = 3.8 Identities = 10/31 (32%), Positives = 15/31 (48%) Frame = -2 Query: 454 KHGGISTGS*YNNFFSTSLQVSRCFICSGKD 362 KH I FF S++ +R ++C KD Sbjct: 48 KHYNIFACDGCAGFFKRSIRRNRQYVCKAKD 78 >AF219117-1|AAF71999.1| 406|Tribolium castaneum tailless ortholog protein. Length = 406 Score = 22.2 bits (45), Expect = 3.8 Identities = 10/31 (32%), Positives = 15/31 (48%) Frame = -2 Query: 454 KHGGISTGS*YNNFFSTSLQVSRCFICSGKD 362 KH I FF S++ +R ++C KD Sbjct: 48 KHYNIFACDGCAGFFKRSIRRNRQYVCKAKD 78 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 159,519 Number of Sequences: 336 Number of extensions: 3458 Number of successful extensions: 8 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 16865010 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -