BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P01_F_H05 (653 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value U66709-1|AAB07515.1| 182|Apis mellifera ankyrin protein. 21 7.9 AY569721-1|AAS86674.1| 400|Apis mellifera complementary sex det... 21 7.9 >U66709-1|AAB07515.1| 182|Apis mellifera ankyrin protein. Length = 182 Score = 21.4 bits (43), Expect = 7.9 Identities = 10/33 (30%), Positives = 17/33 (51%) Frame = +3 Query: 258 PCLLTVTKLPFSQKGTLRPFHGEKLGLNMLXSL 356 P LT+ + KG + + GE+ L +L S+ Sbjct: 51 PITLTIPVPQAANKGMINQYGGEQPTLRLLCSI 83 >AY569721-1|AAS86674.1| 400|Apis mellifera complementary sex determiner protein. Length = 400 Score = 21.4 bits (43), Expect = 7.9 Identities = 9/28 (32%), Positives = 17/28 (60%) Frame = -2 Query: 628 INSFLCSSCGMNSSHQALNNFKVIMNNL 545 I S L +SC ++++ NN+K + N+ Sbjct: 303 IISSLSNSCNYSNNYYNNNNYKKLYYNI 330 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 187,249 Number of Sequences: 438 Number of extensions: 3872 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 19804986 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -