BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P01_F_H03 (651 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AJ005083-1|CAB65469.1| 585|Tribolium castaneum signal receptor ... 25 0.41 AF264721-1|AAF75273.1| 126|Tribolium castaneum putative cytochr... 24 0.94 EF468474-1|ABR25244.1| 516|Tribolium castaneum methoprene-toler... 22 3.8 AY293621-1|AAP46162.1| 392|Tribolium castaneum glass protein pr... 22 3.8 AJ829922-1|CAH25640.1| 193|Tribolium castaneum twist bHLH trans... 22 3.8 S73225-1|AAB30811.1| 327|Tribolium castaneum protein ( Triboliu... 21 6.7 DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 21 6.7 AY337337-1|AAP94192.1| 505|Tribolium castaneum cytochrome P450 ... 21 8.8 AF264720-1|AAF75272.1| 126|Tribolium castaneum putative cytochr... 21 8.8 AF254755-1|AAF70496.1| 505|Tribolium castaneum cytochrome P450 ... 21 8.8 >AJ005083-1|CAB65469.1| 585|Tribolium castaneum signal receptor protein protein. Length = 585 Score = 25.4 bits (53), Expect = 0.41 Identities = 11/27 (40%), Positives = 12/27 (44%) Frame = -3 Query: 82 NLAAMMCCRETECGGDANXDCNTEECV 2 N A C E G N DCN EC+ Sbjct: 527 NCTASTRCWEVFMDGICNEDCNNPECL 553 >AF264721-1|AAF75273.1| 126|Tribolium castaneum putative cytochrome P450 monooxigenaseCYP4Q2 protein. Length = 126 Score = 24.2 bits (50), Expect = 0.94 Identities = 14/48 (29%), Positives = 25/48 (52%) Frame = +3 Query: 312 RAALGDANGKAKEALEQSRQNIERTAEELRKAHPDVEKNATALREKLQ 455 R LGD + K + Q+ + +ER +E + +P V + AL E ++ Sbjct: 27 RDVLGDIHAKPTYSDLQNLKYLERCIKESLRLYPSVHLISRALGEDVR 74 >EF468474-1|ABR25244.1| 516|Tribolium castaneum methoprene-tolerant protein. Length = 516 Score = 22.2 bits (45), Expect = 3.8 Identities = 10/26 (38%), Positives = 17/26 (65%), Gaps = 1/26 (3%) Frame = +2 Query: 89 SLRLHRSGPRSDGATRRS-RLLQGHR 163 ++RL R+GPR++ A R++ HR Sbjct: 179 NIRLKRAGPRTESAVYEPVRIMGVHR 204 >AY293621-1|AAP46162.1| 392|Tribolium castaneum glass protein protein. Length = 392 Score = 22.2 bits (45), Expect = 3.8 Identities = 11/34 (32%), Positives = 17/34 (50%) Frame = -3 Query: 454 CSFSRRAVAFFSTSGWALRSSSAVRSMFCLDCSK 353 C ++ A ST LR+ S + C+DC+K Sbjct: 252 CRICGKSYARPSTLKTHLRTHSGEKPYRCIDCNK 285 >AJ829922-1|CAH25640.1| 193|Tribolium castaneum twist bHLH transcription factor protein. Length = 193 Score = 22.2 bits (45), Expect = 3.8 Identities = 8/13 (61%), Positives = 10/13 (76%) Frame = +3 Query: 129 RRDAPDFFKDIEH 167 RR AP F+DI+H Sbjct: 84 RRKAPQSFEDIQH 96 >S73225-1|AAB30811.1| 327|Tribolium castaneum protein ( Tribolium castaneum homeodomainprotein mRNA, complete cds. ). Length = 327 Score = 21.4 bits (43), Expect = 6.7 Identities = 13/33 (39%), Positives = 19/33 (57%), Gaps = 3/33 (9%) Frame = +3 Query: 135 DAPDFFKDIEHHTKAVP*DFSNNSL---TRSPS 224 D P FK+IE H A+ +N++L +SPS Sbjct: 37 DTPLSFKNIESHLNAIS-QITNSTLDPGRKSPS 68 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 21.4 bits (43), Expect = 6.7 Identities = 9/28 (32%), Positives = 12/28 (42%) Frame = -1 Query: 399 GAPRPCARCSASTVPKPPWPCRSRLRAL 316 G P+P + CS + P C L L Sbjct: 1271 GGPQPYSACSENAFAAYPGDCTRYLHCL 1298 >AY337337-1|AAP94192.1| 505|Tribolium castaneum cytochrome P450 monooxygenase protein. Length = 505 Score = 21.0 bits (42), Expect = 8.8 Identities = 13/44 (29%), Positives = 20/44 (45%) Frame = +3 Query: 321 LGDANGKAKEALEQSRQNIERTAEELRKAHPDVEKNATALREKL 452 LGD K Q + +ER +E+ + +P V + L E L Sbjct: 346 LGDIKKKPTYQDLQEMKYLERCVKEVLRLYPSVHFISRKLGEDL 389 >AF264720-1|AAF75272.1| 126|Tribolium castaneum putative cytochrome P450 monooxigenaseCYP4Q1 protein. Length = 126 Score = 21.0 bits (42), Expect = 8.8 Identities = 13/47 (27%), Positives = 22/47 (46%) Frame = +3 Query: 312 RAALGDANGKAKEALEQSRQNIERTAEELRKAHPDVEKNATALREKL 452 R LGD + K Q+ + +ER +E + +P V + L + L Sbjct: 27 REVLGDLSKKPSYNDLQNLKYLERCIKETLRLYPSVHFISRTLGQDL 73 >AF254755-1|AAF70496.1| 505|Tribolium castaneum cytochrome P450 monooxigenase CYP4Q7 protein. Length = 505 Score = 21.0 bits (42), Expect = 8.8 Identities = 13/44 (29%), Positives = 20/44 (45%) Frame = +3 Query: 321 LGDANGKAKEALEQSRQNIERTAEELRKAHPDVEKNATALREKL 452 LGD K Q + +ER +E+ + +P V + L E L Sbjct: 346 LGDIKKKPTYQDLQEMKYLERCVKEVLRLYPSVHFISRKLGEDL 389 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 106,023 Number of Sequences: 336 Number of extensions: 1752 Number of successful extensions: 14 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 14 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 14 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 16760905 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -