BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P01_F_G19 (652 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC112350-1|AAI12351.1| 955|Homo sapiens THRAP3 protein protein. 33 0.67 BC112330-1|AAI12331.1| 955|Homo sapiens thyroid hormone recepto... 33 0.67 AL591845-1|CAH71859.1| 955|Homo sapiens thyroid hormone recepto... 33 0.67 AF117756-1|AAD22034.1| 955|Homo sapiens thyroid hormone recepto... 33 0.67 AJ131693-1|CAB40713.1| 3908|Homo sapiens AKAP450 protein protein. 30 8.2 AJ010770-1|CAA09361.1| 3911|Homo sapiens Hyperion protein protein. 30 8.2 AF083037-1|AAD22767.1| 3595|Homo sapiens A-kinase anchoring prot... 30 8.2 AF026245-1|AAB86384.1| 1642|Homo sapiens yotiao protein. 30 8.2 AC000066-1|AAC60380.1| 1620|Homo sapiens yotiao protein. 30 8.2 AB019691-1|BAA78718.1| 3899|Homo sapiens Centrosome- and Golgi-l... 30 8.2 >BC112350-1|AAI12351.1| 955|Homo sapiens THRAP3 protein protein. Length = 955 Score = 33.5 bits (73), Expect = 0.67 Identities = 14/39 (35%), Positives = 24/39 (61%) Frame = +2 Query: 269 KLHGLQATSITLNDRFTLLSTAGTDRAAMRMKKRPTVHQ 385 K H ++ +TL++RFT GT++ A + KK P +H+ Sbjct: 639 KEHHFGSSGMTLHERFTKYLKRGTEQEAAKNKKSPEIHR 677 >BC112330-1|AAI12331.1| 955|Homo sapiens thyroid hormone receptor associated protein 3 protein. Length = 955 Score = 33.5 bits (73), Expect = 0.67 Identities = 14/39 (35%), Positives = 24/39 (61%) Frame = +2 Query: 269 KLHGLQATSITLNDRFTLLSTAGTDRAAMRMKKRPTVHQ 385 K H ++ +TL++RFT GT++ A + KK P +H+ Sbjct: 639 KEHHFGSSGMTLHERFTKYLKRGTEQEAAKNKKSPEIHR 677 >AL591845-1|CAH71859.1| 955|Homo sapiens thyroid hormone receptor associated protein 3 protein. Length = 955 Score = 33.5 bits (73), Expect = 0.67 Identities = 14/39 (35%), Positives = 24/39 (61%) Frame = +2 Query: 269 KLHGLQATSITLNDRFTLLSTAGTDRAAMRMKKRPTVHQ 385 K H ++ +TL++RFT GT++ A + KK P +H+ Sbjct: 639 KEHHFGSSGMTLHERFTKYLKRGTEQEAAKNKKSPEIHR 677 >AF117756-1|AAD22034.1| 955|Homo sapiens thyroid hormone receptor-associated protein complex component TRAP150 protein. Length = 955 Score = 33.5 bits (73), Expect = 0.67 Identities = 14/39 (35%), Positives = 24/39 (61%) Frame = +2 Query: 269 KLHGLQATSITLNDRFTLLSTAGTDRAAMRMKKRPTVHQ 385 K H ++ +TL++RFT GT++ A + KK P +H+ Sbjct: 639 KEHHFGSSGMTLHERFTKYLKRGTEQEAAKNKKSPEIHR 677 >AJ131693-1|CAB40713.1| 3908|Homo sapiens AKAP450 protein protein. Length = 3908 Score = 29.9 bits (64), Expect = 8.2 Identities = 16/58 (27%), Positives = 29/58 (50%) Frame = -1 Query: 469 RPLHLILQLSSDLVNQETVXYVQGLCKVLMYGRTFFHAHSSAISSGSREQSKSIVQGN 296 +PLHL++ V++E ++Q LC VL G + A +++ +E S + N Sbjct: 1182 KPLHLLIGKLQKAVSEECSYFLQTLCSVL--GEYYTPALKCEVNAEDKENSGDYISEN 1237 >AJ010770-1|CAA09361.1| 3911|Homo sapiens Hyperion protein protein. Length = 3911 Score = 29.9 bits (64), Expect = 8.2 Identities = 16/58 (27%), Positives = 29/58 (50%) Frame = -1 Query: 469 RPLHLILQLSSDLVNQETVXYVQGLCKVLMYGRTFFHAHSSAISSGSREQSKSIVQGN 296 +PLHL++ V++E ++Q LC VL G + A +++ +E S + N Sbjct: 1194 KPLHLLIGKLQKAVSEECSYFLQTLCSVL--GEYYTPALKCEVNAEDKENSGDYISEN 1249 >AF083037-1|AAD22767.1| 3595|Homo sapiens A-kinase anchoring protein AKAP350 protein. Length = 3595 Score = 29.9 bits (64), Expect = 8.2 Identities = 16/58 (27%), Positives = 29/58 (50%) Frame = -1 Query: 469 RPLHLILQLSSDLVNQETVXYVQGLCKVLMYGRTFFHAHSSAISSGSREQSKSIVQGN 296 +PLHL++ V++E ++Q LC VL G + A +++ +E S + N Sbjct: 872 KPLHLLIGKLQKAVSEECSYFLQTLCSVL--GEYYTPALKCEVNAEDKENSGDYISEN 927 >AF026245-1|AAB86384.1| 1642|Homo sapiens yotiao protein. Length = 1642 Score = 29.9 bits (64), Expect = 8.2 Identities = 16/58 (27%), Positives = 29/58 (50%) Frame = -1 Query: 469 RPLHLILQLSSDLVNQETVXYVQGLCKVLMYGRTFFHAHSSAISSGSREQSKSIVQGN 296 +PLHL++ V++E ++Q LC VL G + A +++ +E S + N Sbjct: 1194 KPLHLLIGKLQKAVSEECSYFLQTLCSVL--GEYYTPALKCEVNAEDKENSGDYISEN 1249 >AC000066-1|AAC60380.1| 1620|Homo sapiens yotiao protein. Length = 1620 Score = 29.9 bits (64), Expect = 8.2 Identities = 16/58 (27%), Positives = 29/58 (50%) Frame = -1 Query: 469 RPLHLILQLSSDLVNQETVXYVQGLCKVLMYGRTFFHAHSSAISSGSREQSKSIVQGN 296 +PLHL++ V++E ++Q LC VL G + A +++ +E S + N Sbjct: 1163 KPLHLLIGKLQKAVSEECSYFLQTLCSVL--GEYYTPALKCEVNAEDKENSGDYISEN 1218 >AB019691-1|BAA78718.1| 3899|Homo sapiens Centrosome- and Golgi-localized PKN-associated protein (CG-NAP) protein. Length = 3899 Score = 29.9 bits (64), Expect = 8.2 Identities = 16/58 (27%), Positives = 29/58 (50%) Frame = -1 Query: 469 RPLHLILQLSSDLVNQETVXYVQGLCKVLMYGRTFFHAHSSAISSGSREQSKSIVQGN 296 +PLHL++ V++E ++Q LC VL G + A +++ +E S + N Sbjct: 1182 KPLHLLIGKLQKAVSEECSYFLQTLCSVL--GEYYTPALKCEVNAEDKENSGDYISEN 1237 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 81,256,232 Number of Sequences: 237096 Number of extensions: 1474468 Number of successful extensions: 2218 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 2147 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2218 length of database: 76,859,062 effective HSP length: 87 effective length of database: 56,231,710 effective search space used: 7253890590 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -