BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P01_F_G14 (638 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 04_04_1357 + 32860677-32860781,32861484-32861588,32861678-328617... 27 9.5 >04_04_1357 + 32860677-32860781,32861484-32861588,32861678-32861728, 32861829-32861949,32862495-32862616,32863032-32863133, 32863226-32863300,32863391-32863470,32863601-32863751, 32863850-32864080,32864221-32864517,32864638-32864751, 32864857-32865030 Length = 575 Score = 27.5 bits (58), Expect = 9.5 Identities = 13/30 (43%), Positives = 20/30 (66%) Frame = -2 Query: 421 TISSGKTLKTLNRQKKSFYYLVLSLKKNNS 332 T+ SG+ L ++ KS Y+VLSLKK+ + Sbjct: 446 TVISGEDLPAMDMNGKSDPYVVLSLKKSKT 475 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,736,432 Number of Sequences: 37544 Number of extensions: 189191 Number of successful extensions: 328 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 309 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 328 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1573040476 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -