BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P01_F_F21 (649 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY752908-1|AAV30082.1| 103|Anopheles gambiae peroxidase 13B pro... 24 4.8 AF042732-3|AAC18058.1| 496|Anopheles gambiae diphenol oxidase-A... 23 6.3 AJ010903-1|CAA09389.1| 373|Anopheles gambiae ICHIT protein prot... 23 8.3 >AY752908-1|AAV30082.1| 103|Anopheles gambiae peroxidase 13B protein. Length = 103 Score = 23.8 bits (49), Expect = 4.8 Identities = 11/25 (44%), Positives = 16/25 (64%) Frame = -1 Query: 382 KPLQGLLRSDD*ACVLFILFPQVRE 308 +PLQG L AC++ I F Q+R+ Sbjct: 74 RPLQGGLVGPTFACIIAIQFRQLRK 98 >AF042732-3|AAC18058.1| 496|Anopheles gambiae diphenol oxidase-A2 protein. Length = 496 Score = 23.4 bits (48), Expect = 6.3 Identities = 12/31 (38%), Positives = 16/31 (51%) Frame = +3 Query: 459 PKT*CNILLCRILXYLYSSXMNKVEYSMMHR 551 P+T N R L YL K+EYS+ H+ Sbjct: 240 PETASNNECARFLYYLGRIKAAKLEYSVAHK 270 >AJ010903-1|CAA09389.1| 373|Anopheles gambiae ICHIT protein protein. Length = 373 Score = 23.0 bits (47), Expect = 8.3 Identities = 7/16 (43%), Positives = 10/16 (62%) Frame = +2 Query: 116 FLHPLGCGWYYLPHLR 163 F+HP C +Y H+R Sbjct: 45 FIHPTNCSRFYECHMR 60 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 668,148 Number of Sequences: 2352 Number of extensions: 12519 Number of successful extensions: 25 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 25 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 25 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 63977715 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -