BLASTX 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= fe100P01_F_F17
(386 letters)
Database: arabidopsis
28,952 sequences; 12,070,560 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
At4g39760.1 68417.m05631 kelch repeat-containing F-box family pr... 27 3.3
>At4g39760.1 68417.m05631 kelch repeat-containing F-box family
protein contains F-box domain Pfam:PF00646 and Kelch
motif Pfam:PF01344
Length = 369
Score = 27.5 bits (58), Expect = 3.3
Identities = 17/53 (32%), Positives = 30/53 (56%), Gaps = 3/53 (5%)
Frame = -3
Query: 351 KDSSSVFVNFALAAVMMSRQRHMYYGRVCRHLS*R---WYKVKKIDFLHTTRK 202
K + +VF NF+ + + R++YY + C L + W K+K +DFL+ R+
Sbjct: 248 KVTEAVF-NFSWCVI--EKVRYIYYNKNCWWLDTKSKDWRKIKGLDFLNKFRE 297
Database: arabidopsis
Posted date: Oct 4, 2007 10:56 AM
Number of letters in database: 12,070,560
Number of sequences in database: 28,952
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 6,322,864
Number of Sequences: 28952
Number of extensions: 98464
Number of successful extensions: 181
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 179
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 181
length of database: 12,070,560
effective HSP length: 73
effective length of database: 9,957,064
effective search space used: 547638520
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
- SilkBase 1999-2023 -