BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P01_F_F07 (514 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AC087079-6|AAK27864.1| 111|Caenorhabditis elegans Ribosomal pro... 62 2e-10 U89307-1|AAB48625.1| 111|Caenorhabditis elegans ribosomal prote... 59 2e-09 >AC087079-6|AAK27864.1| 111|Caenorhabditis elegans Ribosomal protein, acidic protein 1 protein. Length = 111 Score = 62.5 bits (145), Expect = 2e-10 Identities = 27/34 (79%), Positives = 31/34 (91%) Frame = +2 Query: 134 DDDVAVTGEKISTILKAAAVXVEPYWPGLFAKAL 235 DD+VA+TGEKI+T+LKAA V EPYWPGLFAKAL Sbjct: 18 DDEVAITGEKIATLLKAANVEFEPYWPGLFAKAL 51 >U89307-1|AAB48625.1| 111|Caenorhabditis elegans ribosomal protein P1 homolog protein. Length = 111 Score = 58.8 bits (136), Expect = 2e-09 Identities = 26/34 (76%), Positives = 30/34 (88%) Frame = +2 Query: 134 DDDVAVTGEKISTILKAAAVXVEPYWPGLFAKAL 235 DD+VA+TGEKI+T+LKAA V EP WPGLFAKAL Sbjct: 18 DDEVAITGEKIATLLKAANVEFEPNWPGLFAKAL 51 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,702,703 Number of Sequences: 27780 Number of extensions: 138880 Number of successful extensions: 302 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 290 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 302 length of database: 12,740,198 effective HSP length: 77 effective length of database: 10,601,138 effective search space used: 985905834 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -