BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P01_F_F06 (481 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_28292| Best HMM Match : RVT_1 (HMM E-Value=2.3e-38) 33 0.16 SB_55184| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.6 SB_20701| Best HMM Match : DUF1027 (HMM E-Value=2.4) 28 4.6 SB_33056| Best HMM Match : DUF635 (HMM E-Value=8.7) 27 6.1 SB_28181| Best HMM Match : RVP (HMM E-Value=0.00058) 27 6.1 SB_35199| Best HMM Match : zf-CCHC (HMM E-Value=0.034) 27 6.1 >SB_28292| Best HMM Match : RVT_1 (HMM E-Value=2.3e-38) Length = 469 Score = 32.7 bits (71), Expect = 0.16 Identities = 16/45 (35%), Positives = 23/45 (51%) Frame = +1 Query: 124 TPLTRISNKLGRNVVTNFVRNHSNGGIPGENLPFDIHNRYKLTLY 258 T LT+ ++ RNV+ + H IPGE+ I N Y+L Y Sbjct: 36 TKLTKEEGEIQRNVIHERAKFHQRSQIPGESAESFIRNLYELAEY 80 >SB_55184| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 75 Score = 27.9 bits (59), Expect = 4.6 Identities = 13/37 (35%), Positives = 22/37 (59%) Frame = +1 Query: 73 CFLL*YLLENRXNVKMITPLTRISNKLGRNVVTNFVR 183 CF++ + L R ++++ L R K + VVTNF+R Sbjct: 36 CFVMDFGLTRRTDLELRIKLVRNMPKTCQTVVTNFIR 72 >SB_20701| Best HMM Match : DUF1027 (HMM E-Value=2.4) Length = 229 Score = 27.9 bits (59), Expect = 4.6 Identities = 13/34 (38%), Positives = 17/34 (50%) Frame = +1 Query: 157 RNVVTNFVRNHSNGGIPGENLPFDIHNRYKLTLY 258 RNV+ + H IPGE+ I N Y+L Y Sbjct: 186 RNVIRERAKFHQRSQIPGESAESFIRNLYELAEY 219 >SB_33056| Best HMM Match : DUF635 (HMM E-Value=8.7) Length = 189 Score = 27.5 bits (58), Expect = 6.1 Identities = 13/34 (38%), Positives = 17/34 (50%) Frame = +1 Query: 157 RNVVTNFVRNHSNGGIPGENLPFDIHNRYKLTLY 258 RNV+ + H IPGE+ I N Y+L Y Sbjct: 129 RNVIHERAKFHQRSQIPGESAESFIRNLYELAEY 162 >SB_28181| Best HMM Match : RVP (HMM E-Value=0.00058) Length = 664 Score = 27.5 bits (58), Expect = 6.1 Identities = 13/34 (38%), Positives = 17/34 (50%) Frame = +1 Query: 157 RNVVTNFVRNHSNGGIPGENLPFDIHNRYKLTLY 258 RNV+ + H IPGE+ I N Y+L Y Sbjct: 75 RNVIHERAKFHQRSQIPGESAESFIRNLYELAEY 108 >SB_35199| Best HMM Match : zf-CCHC (HMM E-Value=0.034) Length = 327 Score = 27.5 bits (58), Expect = 6.1 Identities = 13/34 (38%), Positives = 17/34 (50%) Frame = +1 Query: 157 RNVVTNFVRNHSNGGIPGENLPFDIHNRYKLTLY 258 RNV+ + H IPGE+ I N Y+L Y Sbjct: 75 RNVIHERAKFHQRSQIPGESAESFIRNLYELAEY 108 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,498,181 Number of Sequences: 59808 Number of extensions: 237939 Number of successful extensions: 474 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 442 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 474 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 1001731762 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -