BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P01_F_F06 (481 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecul... 23 2.2 AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member A... 23 2.2 AF004169-1|AAC13418.1| 371|Apis mellifera ultraviolet-sensitive... 22 3.0 AB022908-1|BAA86909.1| 493|Apis mellifera amylase protein. 21 6.9 >AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecule AbsCAM-Ig7B protein. Length = 1923 Score = 22.6 bits (46), Expect = 2.2 Identities = 13/35 (37%), Positives = 17/35 (48%) Frame = -3 Query: 212 SPGIPPLEWFLTKFVTTFLPSLFEMRVSGVIIFTF 108 +PGIPP FL+ TT + L +G I F Sbjct: 1498 APGIPPAATFLSPNSTTLVLRLHVWPDNGCPILYF 1532 >AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member AbsCAM-Ig7A protein. Length = 1919 Score = 22.6 bits (46), Expect = 2.2 Identities = 13/35 (37%), Positives = 17/35 (48%) Frame = -3 Query: 212 SPGIPPLEWFLTKFVTTFLPSLFEMRVSGVIIFTF 108 +PGIPP FL+ TT + L +G I F Sbjct: 1494 APGIPPAATFLSPNSTTLVLRLHVWPDNGCPILYF 1528 >AF004169-1|AAC13418.1| 371|Apis mellifera ultraviolet-sensitive opsin protein. Length = 371 Score = 22.2 bits (45), Expect = 3.0 Identities = 15/38 (39%), Positives = 18/38 (47%) Frame = -3 Query: 221 GRFSPGIPPLEWFLTKFVTTFLPSLFEMRVSGVIIFTF 108 GRF P E FLT +L E+R+ IFTF Sbjct: 186 GRFVP-----EGFLTSCSFDYLTDTNEIRIFVATIFTF 218 >AB022908-1|BAA86909.1| 493|Apis mellifera amylase protein. Length = 493 Score = 21.0 bits (42), Expect = 6.9 Identities = 10/31 (32%), Positives = 15/31 (48%) Frame = +1 Query: 175 FVRNHSNGGIPGENLPFDIHNRYKLTLYFIL 267 FV NH + L + RYK+ + F+L Sbjct: 304 FVDNHDTQRDNPQILTYKYSKRYKMAVAFML 334 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 117,223 Number of Sequences: 438 Number of extensions: 2366 Number of successful extensions: 4 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 146,343 effective HSP length: 53 effective length of database: 123,129 effective search space used: 13051674 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -