BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P01_F_F04 (654 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value EF592538-1|ABQ95984.1| 582|Tribolium castaneum beta-N-acetylglu... 23 1.7 DQ659252-1|ABG47450.1| 377|Tribolium castaneum chitinase 13 pro... 21 6.7 >EF592538-1|ABQ95984.1| 582|Tribolium castaneum beta-N-acetylglucosaminidase NAG3 protein. Length = 582 Score = 23.4 bits (48), Expect = 1.7 Identities = 12/35 (34%), Positives = 20/35 (57%), Gaps = 4/35 (11%) Frame = +3 Query: 534 LKNSNH----AHILNLSPPLNMNPYWFSIHVAYTM 626 LKN+N+ H++ S PL +PY+ + V T+ Sbjct: 404 LKNANNNELPEHVIMWSSPLTESPYFEKLDVKVTV 438 >DQ659252-1|ABG47450.1| 377|Tribolium castaneum chitinase 13 protein. Length = 377 Score = 21.4 bits (43), Expect = 6.7 Identities = 8/22 (36%), Positives = 14/22 (63%) Frame = -3 Query: 322 NAFPPRASISSAAV*IVPGSLG 257 +AF P+ + + AV +PG +G Sbjct: 162 DAFAPKGYLLTVAVNSIPGEVG 183 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 136,693 Number of Sequences: 336 Number of extensions: 2626 Number of successful extensions: 3 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 16865010 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -