BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P01_F_F02 (637 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g50400.1 68418.m06242 calcineurin-like phosphoesterase family... 31 0.85 At4g35710.1 68417.m05068 hypothetical protein contains Pfam prof... 30 1.1 At4g37250.1 68417.m05273 leucine-rich repeat family protein / pr... 28 4.5 At4g19330.1 68417.m02848 kelch repeat-containing F-box family pr... 28 4.5 At1g60410.1 68414.m06801 F-box family protein contains F-box dom... 28 4.5 At5g28400.1 68418.m03448 expressed protein 27 7.9 At1g14560.1 68414.m01731 mitochondrial substrate carrier family ... 27 7.9 >At5g50400.1 68418.m06242 calcineurin-like phosphoesterase family protein contains Pfam profile: PF00149 calcineurin-like phosphoesterase Length = 611 Score = 30.7 bits (66), Expect = 0.85 Identities = 18/66 (27%), Positives = 33/66 (50%), Gaps = 2/66 (3%) Frame = +3 Query: 366 NYEENVEKLAPVQVR-SQEEIMNECQMWWTITGNFGNILP-IDWTKSFSRKMHIPTLNLS 539 N+ + APV R + + +E + WT N G +P ++W++ +R P L+ Sbjct: 158 NHVSFINPKAPVYPRLALGKKWDEMTVTWTSGYNIGEAVPFVEWSRKGTRSRRSPAGTLT 217 Query: 540 DTKNSL 557 T+NS+ Sbjct: 218 FTRNSM 223 >At4g35710.1 68417.m05068 hypothetical protein contains Pfam profile PF03087: Arabidopsis protein of unknown function Length = 283 Score = 30.3 bits (65), Expect = 1.1 Identities = 20/70 (28%), Positives = 35/70 (50%), Gaps = 7/70 (10%) Frame = +3 Query: 243 LVKCKQDNMQNGEGDNFTETFSGSL-------EDLVNTFDEKITKCFGNYEENVEKLAPV 401 ++K K+DN + N ET ++ +DL N +E + C G +E N+E L Sbjct: 213 VLKMKKDN--HAPAKNVLETLDSAIFGDFLSHDDLQNELEE-VEMCIGGFERNLEGLFRR 269 Query: 402 QVRSQEEIMN 431 +R++ I+N Sbjct: 270 LIRTRASILN 279 >At4g37250.1 68417.m05273 leucine-rich repeat family protein / protein kinase family protein contains protein kinase domain, Pfam:PF00069; contains leucine-rich repeats, Pfam:PF00560 Length = 768 Score = 28.3 bits (60), Expect = 4.5 Identities = 14/25 (56%), Positives = 16/25 (64%) Frame = -1 Query: 349 IFSSKVFTKSSREPEKVSVKLSPSP 275 IFSSK +T SSRE + SPSP Sbjct: 617 IFSSKRYTTSSREFSSIGPTPSPSP 641 >At4g19330.1 68417.m02848 kelch repeat-containing F-box family protein very low similarity to SKP1 interacting partner 6 [Arabidopsis thaliana] GI:10716957; contains Pfam profiles PF01344: Kelch motif, PF00646: F-box domain Length = 537 Score = 28.3 bits (60), Expect = 4.5 Identities = 9/26 (34%), Positives = 16/26 (61%) Frame = +3 Query: 432 ECQMWWTITGNFGNILPIDWTKSFSR 509 +C+ W + GN+G L + W ++ SR Sbjct: 439 KCEEWRLVKGNYGGKLVVFWDRAVSR 464 >At1g60410.1 68414.m06801 F-box family protein contains F-box domain Pfam:PF00646 Length = 406 Score = 28.3 bits (60), Expect = 4.5 Identities = 12/21 (57%), Positives = 14/21 (66%) Frame = -1 Query: 310 PEKVSVKLSPSPFCMLSCLHF 248 PE +KLSP P C+LS L F Sbjct: 353 PEMEEIKLSPVPQCVLSSLDF 373 >At5g28400.1 68418.m03448 expressed protein Length = 996 Score = 27.5 bits (58), Expect = 7.9 Identities = 28/110 (25%), Positives = 47/110 (42%), Gaps = 6/110 (5%) Frame = +3 Query: 303 FSGSLEDLVNTFDEKITKCFGNYEENVEKLAP----VQVRSQEEIMNEC--QMWWTITGN 464 F SLE V +EK++ Y+ +EK+ P + E +N Q +G Sbjct: 650 FLQSLEKKVEKENEKLSHLHHVYDP-LEKIIPRWKGPSLDKNPEFLNNYHEQREALFSGK 708 Query: 465 FGNILPIDWTKSFSRKMHIPTLNLSDTKNSLTPDDXIHSSQXEAVASDLD 614 ++ P+ + + S H + ++N+LTP I SSQ + V D Sbjct: 709 AASVSPVKYEEQSS---HQELSESASSENTLTPSSEITSSQPKIVVEGSD 755 >At1g14560.1 68414.m01731 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 331 Score = 27.5 bits (58), Expect = 7.9 Identities = 13/43 (30%), Positives = 25/43 (58%), Gaps = 1/43 (2%) Frame = -3 Query: 368 VSETFRDFL-IEGVHQIFKRTGESLSEIIPFAVLHVVLFTLHQ 243 VS++ + L +G +K G S+ IIP+A LH + + +++ Sbjct: 63 VSQSLKKVLQFDGPLGFYKGNGASVIRIIPYAALHYMTYEVYR 105 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,149,863 Number of Sequences: 28952 Number of extensions: 232431 Number of successful extensions: 707 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 691 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 707 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1305036432 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -