BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P01_F_E24 (649 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_A4VDS6 Cluster: Putative uncharacterized protein; n=1; ... 34 3.4 UniRef50_A2G4B9 Cluster: Ankyrin repeat protein, putative; n=1; ... 33 4.5 >UniRef50_A4VDS6 Cluster: Putative uncharacterized protein; n=1; Tetrahymena thermophila SB210|Rep: Putative uncharacterized protein - Tetrahymena thermophila SB210 Length = 239 Score = 33.9 bits (74), Expect = 3.4 Identities = 14/28 (50%), Positives = 22/28 (78%), Gaps = 1/28 (3%) Frame = +1 Query: 406 VIIYFKINH-KNLFYSFKLVSFYWFLKI 486 V +YFK+ H KNLF+ FKL++F ++ +I Sbjct: 110 VFLYFKVIHSKNLFFFFKLINFLFYSEI 137 >UniRef50_A2G4B9 Cluster: Ankyrin repeat protein, putative; n=1; Trichomonas vaginalis G3|Rep: Ankyrin repeat protein, putative - Trichomonas vaginalis G3 Length = 239 Score = 33.5 bits (73), Expect = 4.5 Identities = 14/36 (38%), Positives = 21/36 (58%) Frame = +3 Query: 486 NNMALFYEYFTITTIINYLYLYNPMIILSSIINFYI 593 NN+ F YF IT IN ++Y+P L S+ ++I Sbjct: 47 NNLHAFLVYFDITNDINNCFVYSPCFHLQSLCEYFI 82 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 518,557,994 Number of Sequences: 1657284 Number of extensions: 8910771 Number of successful extensions: 17868 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 17246 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 17862 length of database: 575,637,011 effective HSP length: 97 effective length of database: 414,880,463 effective search space used: 48955894634 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -