BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P01_F_E22 (649 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ659253-1|ABG47451.1| 439|Tribolium castaneum imaginal disc gr... 22 5.0 AY884064-1|AAX84205.1| 683|Tribolium castaneum pro-phenol oxida... 22 5.0 AM295015-1|CAL25730.1| 549|Tribolium castaneum ecdysone recepto... 22 5.0 >DQ659253-1|ABG47451.1| 439|Tribolium castaneum imaginal disc growth factor 2 protein. Length = 439 Score = 21.8 bits (44), Expect = 5.0 Identities = 10/20 (50%), Positives = 14/20 (70%) Frame = -3 Query: 347 HDLKNLIIQGRAEEEINDLE 288 +D K+ QG+A+ EI DLE Sbjct: 30 YDSKSHFRQGQAKFEITDLE 49 Score = 21.0 bits (42), Expect = 8.7 Identities = 12/37 (32%), Positives = 14/37 (37%) Frame = -3 Query: 647 RXWRRHNTSTTRGRNQPDCYGTTLAGDLARDGVWLSY 537 R W + S G G AG L +D LSY Sbjct: 302 RAWAMDDESDINGTPPLHISGPAEAGPLTKDAGLLSY 338 >AY884064-1|AAX84205.1| 683|Tribolium castaneum pro-phenol oxidase subunit 2 protein. Length = 683 Score = 21.8 bits (44), Expect = 5.0 Identities = 7/22 (31%), Positives = 11/22 (50%) Frame = +2 Query: 569 HRQVWFRNSPADSCPSWYWYCV 634 HR +FR + W+W+ V Sbjct: 192 HRLAYFREDLGINLHHWHWHLV 213 >AM295015-1|CAL25730.1| 549|Tribolium castaneum ecdysone receptor (isoform A) protein. Length = 549 Score = 21.8 bits (44), Expect = 5.0 Identities = 10/31 (32%), Positives = 16/31 (51%) Frame = -3 Query: 488 KDNSASNGSGDFLAALHTQTNMTVVVANGNK 396 K NS +NGS D + ++ + NG+K Sbjct: 279 KPNSTTNGSPDVIKVEPELSDSEKTLCNGSK 309 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 137,758 Number of Sequences: 336 Number of extensions: 2774 Number of successful extensions: 9 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 16656800 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -