BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P01_F_E22 (649 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_4413| Best HMM Match : No HMM Matches (HMM E-Value=.) 284 5e-77 SB_53780| Best HMM Match : RVT_1 (HMM E-Value=0.0007) 29 2.5 SB_11257| Best HMM Match : GCC2_GCC3 (HMM E-Value=2.7e-11) 29 3.3 SB_32523| Best HMM Match : 7tm_1 (HMM E-Value=1.4e-17) 28 5.7 SB_32128| Best HMM Match : Collagen (HMM E-Value=0.31) 28 5.7 SB_30332| Best HMM Match : RVT_1 (HMM E-Value=2.7e-34) 28 7.5 SB_20635| Best HMM Match : rve (HMM E-Value=0.91) 28 7.5 SB_5251| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.5 SB_54962| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.5 SB_52533| Best HMM Match : rve (HMM E-Value=2) 28 7.5 SB_42712| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.5 SB_25521| Best HMM Match : NLPC_P60 (HMM E-Value=5.7) 28 7.5 SB_17882| Best HMM Match : ShTK (HMM E-Value=1e-05) 28 7.5 SB_8063| Best HMM Match : Homeobox (HMM E-Value=8.5e-24) 28 7.5 SB_993| Best HMM Match : rve (HMM E-Value=2.7e-33) 28 7.5 SB_37212| Best HMM Match : zf-C2H2 (HMM E-Value=2e-23) 27 9.9 >SB_4413| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 252 Score = 284 bits (696), Expect = 5e-77 Identities = 134/151 (88%), Positives = 140/151 (92%) Frame = +3 Query: 195 WVPVTKLGRLVREGKIDKLESIYLFSLPIKEFEIIDFFLGPSLNDEVLKIMPVQKQTRAG 374 WVPVTKLGRLV++ KI LE IYLFSLPIKEFEIIDFFLG +L DEVLKIMPVQKQTRAG Sbjct: 8 WVPVTKLGRLVKDLKIKTLEHIYLFSLPIKEFEIIDFFLGAALKDEVLKIMPVQKQTRAG 67 Query: 375 QRTRFXAFVAIGDNNGHIGLGVKCSKEVATAIRGAIILAKLSVLPVRXGYWGNKIGKPHT 554 QRTRF AFVAIGD+NGH+GLGVKCSKEVATAIRGAIILAKLSV+PVR GYWGNKIGKPHT Sbjct: 68 QRTRFKAFVAIGDSNGHVGLGVKCSKEVATAIRGAIILAKLSVIPVRRGYWGNKIGKPHT 127 Query: 555 VPCKVTGKCGSVTVRLIPAPRGTGIVSAPXP 647 VPCKVTGKCGS VRLIPAPRGTGIVSAP P Sbjct: 128 VPCKVTGKCGSTRVRLIPAPRGTGIVSAPVP 158 >SB_53780| Best HMM Match : RVT_1 (HMM E-Value=0.0007) Length = 280 Score = 29.5 bits (63), Expect = 2.5 Identities = 19/44 (43%), Positives = 23/44 (52%) Frame = -3 Query: 470 NGSGDFLAALHTQTNMTVVVANGNKCXETCALSGTCLFLYRHDL 339 N G LA + N+ +V NG K + C LS T L LY HDL Sbjct: 108 NAYGKSLAEFYNSNNL--IVLNGVK--QGCMLSPTLLNLYVHDL 147 >SB_11257| Best HMM Match : GCC2_GCC3 (HMM E-Value=2.7e-11) Length = 3810 Score = 29.1 bits (62), Expect = 3.3 Identities = 16/42 (38%), Positives = 18/42 (42%), Gaps = 2/42 (4%) Frame = +3 Query: 504 LPVRXGYWGNKIG--KPHTVPCKVTGKCGSVTVRLIPAPRGT 623 LP GYW N G P PC V C + + P P GT Sbjct: 3355 LPCPAGYWCNIKGLADPSISPCPVGHYCLNAIDKPTPCPNGT 3396 >SB_32523| Best HMM Match : 7tm_1 (HMM E-Value=1.4e-17) Length = 1130 Score = 28.3 bits (60), Expect = 5.7 Identities = 8/19 (42%), Positives = 12/19 (63%) Frame = +2 Query: 374 TAHTFQXICCHWRQQRSYW 430 TA + ICCH +Q + +W Sbjct: 486 TADQYDAICCHTQQSKKFW 504 >SB_32128| Best HMM Match : Collagen (HMM E-Value=0.31) Length = 330 Score = 28.3 bits (60), Expect = 5.7 Identities = 12/41 (29%), Positives = 17/41 (41%) Frame = +3 Query: 519 GYWGNKIGKPHTVPCKVTGKCGSVTVRLIPAPRGTGIVSAP 641 GY G ++G P +TG G RL P ++ P Sbjct: 112 GYTGERLGPTAHAPASITGPVGYADERLGPTAHAPASITGP 152 Score = 28.3 bits (60), Expect = 5.7 Identities = 12/41 (29%), Positives = 17/41 (41%) Frame = +3 Query: 519 GYWGNKIGKPHTVPCKVTGKCGSVTVRLIPAPRGTGIVSAP 641 GY G ++G P +TG G RL P ++ P Sbjct: 196 GYTGERLGPTAHAPASITGPVGYADERLGPTAHAPASITGP 236 Score = 27.9 bits (59), Expect = 7.5 Identities = 12/41 (29%), Positives = 17/41 (41%) Frame = +3 Query: 519 GYWGNKIGKPHTVPCKVTGKCGSVTVRLIPAPRGTGIVSAP 641 GY G ++G P +TG G RL P ++ P Sbjct: 49 GYAGKRLGPTAHAPASITGPVGYADERLGPTAHAPASITGP 89 >SB_30332| Best HMM Match : RVT_1 (HMM E-Value=2.7e-34) Length = 1683 Score = 27.9 bits (59), Expect = 7.5 Identities = 16/61 (26%), Positives = 30/61 (49%), Gaps = 2/61 (3%) Frame = +3 Query: 351 VQKQTRAGQRTRFXAFVAIGDNNGHIGLGV--KCSKEVATAIRGAIILAKLSVLPVRXGY 524 +Q+ TR +RT +NN ++ LG+ C + TA+ G +L+ + ++ G Sbjct: 1460 IQENTRTSRRTDISYRQLQANNNKNLELGIWRHCGPAILTALSG----RRLACVKIQAGP 1515 Query: 525 W 527 W Sbjct: 1516 W 1516 >SB_20635| Best HMM Match : rve (HMM E-Value=0.91) Length = 748 Score = 27.9 bits (59), Expect = 7.5 Identities = 12/38 (31%), Positives = 19/38 (50%) Frame = +3 Query: 324 NDEVLKIMPVQKQTRAGQRTRFXAFVAIGDNNGHIGLG 437 N +LK++ + Q +A + F FVA + H G G Sbjct: 155 NRSILKVLKIATQEKADMQREFRKFVAAYRSTPHTGTG 192 >SB_5251| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 945 Score = 27.9 bits (59), Expect = 7.5 Identities = 12/38 (31%), Positives = 19/38 (50%) Frame = +3 Query: 324 NDEVLKIMPVQKQTRAGQRTRFXAFVAIGDNNGHIGLG 437 N +LK++ + Q +A + F FVA + H G G Sbjct: 811 NRSILKVLKIATQEKADMQREFRKFVAAYRSTPHTGTG 848 >SB_54962| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2211 Score = 27.9 bits (59), Expect = 7.5 Identities = 12/38 (31%), Positives = 19/38 (50%) Frame = +3 Query: 324 NDEVLKIMPVQKQTRAGQRTRFXAFVAIGDNNGHIGLG 437 N +LK++ + Q +A + F FVA + H G G Sbjct: 2008 NRSILKVLKIATQEKADMQREFRKFVAAYRSTPHTGTG 2045 >SB_52533| Best HMM Match : rve (HMM E-Value=2) Length = 212 Score = 27.9 bits (59), Expect = 7.5 Identities = 12/38 (31%), Positives = 19/38 (50%) Frame = +3 Query: 324 NDEVLKIMPVQKQTRAGQRTRFXAFVAIGDNNGHIGLG 437 N +LK++ + Q +A + F FVA + H G G Sbjct: 95 NRSILKVLKIATQEKADMQREFRKFVAAYRSTPHTGTG 132 >SB_42712| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 405 Score = 27.9 bits (59), Expect = 7.5 Identities = 12/41 (29%), Positives = 17/41 (41%) Frame = +3 Query: 519 GYWGNKIGKPHTVPCKVTGKCGSVTVRLIPAPRGTGIVSAP 641 GY G ++G P +TG G RL P ++ P Sbjct: 162 GYAGERLGPTAHAPASITGPVGYADERLGPTAHAPASITGP 202 >SB_25521| Best HMM Match : NLPC_P60 (HMM E-Value=5.7) Length = 212 Score = 27.9 bits (59), Expect = 7.5 Identities = 12/38 (31%), Positives = 19/38 (50%) Frame = +3 Query: 324 NDEVLKIMPVQKQTRAGQRTRFXAFVAIGDNNGHIGLG 437 N +LK++ + Q +A + F FVA + H G G Sbjct: 9 NRSILKVLKIATQEKADMQREFRKFVAAYRSTPHTGTG 46 >SB_17882| Best HMM Match : ShTK (HMM E-Value=1e-05) Length = 387 Score = 27.9 bits (59), Expect = 7.5 Identities = 16/61 (26%), Positives = 30/61 (49%), Gaps = 2/61 (3%) Frame = +3 Query: 351 VQKQTRAGQRTRFXAFVAIGDNNGHIGLGV--KCSKEVATAIRGAIILAKLSVLPVRXGY 524 +Q+ TR +RT +NN ++ LG+ C + TA+ G +L+ + ++ G Sbjct: 274 IQENTRTSRRTDISYRQLQANNNKNLELGIWRHCGPAILTALSG----RRLACVKIQAGP 329 Query: 525 W 527 W Sbjct: 330 W 330 >SB_8063| Best HMM Match : Homeobox (HMM E-Value=8.5e-24) Length = 963 Score = 27.9 bits (59), Expect = 7.5 Identities = 15/44 (34%), Positives = 25/44 (56%) Frame = -1 Query: 499 DSLARIIAPRMAVATSLLHFTPKPI*PLLSPMATNALKRVRCPA 368 D+L+ IAP A SLL + P+++P A +AL ++ P+ Sbjct: 365 DALSLQIAPSANNALSLLKGAYDALSPMIAPSANDALSLLKAPS 408 >SB_993| Best HMM Match : rve (HMM E-Value=2.7e-33) Length = 735 Score = 27.9 bits (59), Expect = 7.5 Identities = 12/38 (31%), Positives = 19/38 (50%) Frame = +3 Query: 324 NDEVLKIMPVQKQTRAGQRTRFXAFVAIGDNNGHIGLG 437 N +LK++ + Q +A + F FVA + H G G Sbjct: 532 NRSILKVLKIATQEKADMQREFRKFVAAYRSTPHTGTG 569 >SB_37212| Best HMM Match : zf-C2H2 (HMM E-Value=2e-23) Length = 827 Score = 27.5 bits (58), Expect = 9.9 Identities = 14/45 (31%), Positives = 20/45 (44%) Frame = -3 Query: 461 GDFLAALHTQTNMTVVVANGNKCXETCALSGTCLFLYRHDLKNLI 327 G+ A H T T+V+ C E C+L FL R N++ Sbjct: 300 GEIFKAEHKITKKTMVIKEETHCNEDCSLLKEVDFLRRLSHPNIV 344 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,391,035 Number of Sequences: 59808 Number of extensions: 389936 Number of successful extensions: 1017 Number of sequences better than 10.0: 16 Number of HSP's better than 10.0 without gapping: 906 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1016 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1645141000 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -