Bombyx BLAST Result against human

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fe100P01_F_E21
         (501 letters)

Database: human 
           237,096 sequences; 76,859,062 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AB046863-1|BAB13469.1|  993|Homo sapiens KIAA1643 protein protein.     30   3.9  

>AB046863-1|BAB13469.1|  993|Homo sapiens KIAA1643 protein protein.
          Length = 993

 Score = 30.3 bits (65), Expect = 3.9
 Identities = 15/56 (26%), Positives = 25/56 (44%)
 Frame = +1

Query: 226 RAPDGGGERPHLAANEMSRVDVVQPNVPGNGDDQYPVREVHAPNPPREKNAQDLKG 393
           +AP      PH + +++     +Q      G  +   RE+HA +PP  +  Q L G
Sbjct: 733 KAPTSDKCLPHTSGSQVDTASGLQGEAGVAGQQEPEARELHAGSPPAHEAPQALSG 788


  Database: human
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 76,859,062
  Number of sequences in database:  237,096
  
Lambda     K      H
   0.310    0.127    0.362 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 48,257,225
Number of Sequences: 237096
Number of extensions: 723615
Number of successful extensions: 1414
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1381
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1414
length of database: 76,859,062
effective HSP length: 85
effective length of database: 56,705,902
effective search space used: 4593178062
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.2 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 42 (21.8 bits)