Bombyx BLAST Result against fruitfly

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fe100P01_F_E21
         (501 letters)

Database: fruitfly 
           53,049 sequences; 24,988,368 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

L05016-1|AAA28643.1| 1156|Drosophila melanogaster hu-li tai shao...    28   8.2  

>L05016-1|AAA28643.1| 1156|Drosophila melanogaster hu-li tai shao
           protein protein.
          Length = 1156

 Score = 27.9 bits (59), Expect = 8.2
 Identities = 12/31 (38%), Positives = 21/31 (67%)
 Frame = +1

Query: 49  KAHVSLSRRPPQEVKLETASIAYSENSTLTV 141
           KA    SRRPP++++ + A++A +E+   TV
Sbjct: 321 KAIYEQSRRPPEDLEKKFAAVAAAEDGAATV 351


  Database: fruitfly
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 24,988,368
  Number of sequences in database:  53,049
  
Lambda     K      H
   0.310    0.127    0.362 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 15,647,326
Number of Sequences: 53049
Number of extensions: 248347
Number of successful extensions: 472
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 465
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 472
length of database: 24,988,368
effective HSP length: 80
effective length of database: 20,744,448
effective search space used: 1784022528
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.2 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 42 (21.8 bits)