BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P01_F_E20 (551 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY753542-1|AAV28545.1| 3361|Anopheles gambiae SGS5 protein. 27 0.54 AF042732-2|AAC18057.1| 179|Anopheles gambiae TU37B2 protein. 25 2.2 >AY753542-1|AAV28545.1| 3361|Anopheles gambiae SGS5 protein. Length = 3361 Score = 26.6 bits (56), Expect = 0.54 Identities = 10/34 (29%), Positives = 20/34 (58%) Frame = +2 Query: 116 SLHIFYFIFQLENGAAAYIQATTVVQHKIKSKKN 217 ++H+ +F+ LEN + TTV+ H + ++ N Sbjct: 933 NIHVRFFMLSLENKPHVFDCYTTVIPHTVLTQYN 966 >AF042732-2|AAC18057.1| 179|Anopheles gambiae TU37B2 protein. Length = 179 Score = 24.6 bits (51), Expect = 2.2 Identities = 13/36 (36%), Positives = 21/36 (58%) Frame = +3 Query: 105 WCNTLYIYFISYFSLKMVQRLTFRRRLSYNTKSNQR 212 W +TL I FIS F+ + + LT+ + Y T+ Q+ Sbjct: 2 WADTLLIVFISIFTALLGEGLTW--VMVYRTEKYQK 35 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 555,632 Number of Sequences: 2352 Number of extensions: 11653 Number of successful extensions: 25 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 24 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 25 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 51301854 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -