BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P01_F_E02 (382 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 04_01_0628 - 8266494-8266501,8266578-8266875,8268055-8268313,826... 31 0.41 08_01_0233 + 1876940-1877509,1907940-1908195,1908290-1908589,190... 29 1.6 03_03_0044 - 14021874-14022050,14022235-14022390,14023024-140232... 26 8.7 >04_01_0628 - 8266494-8266501,8266578-8266875,8268055-8268313, 8268892-8269052,8269553-8269884,8270947-8271265, 8271335-8271420,8271600-8271684 Length = 515 Score = 30.7 bits (66), Expect = 0.41 Identities = 16/38 (42%), Positives = 22/38 (57%), Gaps = 1/38 (2%) Frame = +2 Query: 95 ESQLKGLAKYFNSQTNRGRLNTARA-TYAVMGAVILYF 205 + L+G Y++ Q N RLN A T AV+GA IL + Sbjct: 101 DRSLRGTVVYYDGQMNDSRLNVGLACTAAVVGAAILNY 138 >08_01_0233 + 1876940-1877509,1907940-1908195,1908290-1908589, 1908777-1908939,1908958-1908994,1910122-1910742 Length = 648 Score = 28.7 bits (61), Expect = 1.6 Identities = 15/34 (44%), Positives = 18/34 (52%) Frame = +2 Query: 59 FQIRMAGDSSVDESQLKGLAKYFNSQTNRGRLNT 160 F ++M GD VD+ KGL Y N GRL T Sbjct: 465 FNLKMKGDDGVDKDFSKGLLPY-NVVCRTGRLET 497 >03_03_0044 - 14021874-14022050,14022235-14022390,14023024-14023203, 14023816-14024074,14024178-14024416,14025180-14025260, 14025320-14025328 Length = 366 Score = 26.2 bits (55), Expect = 8.7 Identities = 11/29 (37%), Positives = 18/29 (62%) Frame = +3 Query: 66 SGWPETLLSMNPSSKA*QNTSTVRQTEED 152 SGW ETLL+ +P+ + ++R+ ED Sbjct: 131 SGWFETLLNSHPNVSSNGEIFSIRERRED 159 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 7,099,624 Number of Sequences: 37544 Number of extensions: 108577 Number of successful extensions: 226 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 225 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 226 length of database: 14,793,348 effective HSP length: 74 effective length of database: 12,015,092 effective search space used: 624784784 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -