BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P01_F_D24 (651 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 31 0.008 AF452568-1|AAL57830.1| 243|Tribolium castaneum homeodomain tran... 22 5.0 AF321227-5|AAK16425.1| 292|Tribolium castaneum Zen2 protein. 22 5.0 AF442747-1|AAL40947.1| 669|Tribolium castaneum ABC transmembran... 21 8.8 AF422804-1|AAL56571.1| 669|Tribolium castaneum ABC transmembran... 21 8.8 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 31.1 bits (67), Expect = 0.008 Identities = 14/33 (42%), Positives = 18/33 (54%) Frame = +3 Query: 255 NRKCFREGESRRAPSAGPMLPVAAVTRRTSRTV 353 N +C + S APS PM+P VT TSR + Sbjct: 2281 NTECHPDASSTMAPSTTPMVPDKPVTTTTSRPI 2313 >AF452568-1|AAL57830.1| 243|Tribolium castaneum homeodomain transcription factor Zen2 protein. Length = 243 Score = 21.8 bits (44), Expect = 5.0 Identities = 10/22 (45%), Positives = 12/22 (54%) Frame = -3 Query: 232 TPRCPSGTPSMSPQKGSPDTSA 167 TP+ SMSPQ S + SA Sbjct: 150 TPKTSPNEASMSPQSTSSNNSA 171 >AF321227-5|AAK16425.1| 292|Tribolium castaneum Zen2 protein. Length = 292 Score = 21.8 bits (44), Expect = 5.0 Identities = 10/22 (45%), Positives = 12/22 (54%) Frame = -3 Query: 232 TPRCPSGTPSMSPQKGSPDTSA 167 TP+ SMSPQ S + SA Sbjct: 170 TPKTSPNEASMSPQSTSSNNSA 191 >AF442747-1|AAL40947.1| 669|Tribolium castaneum ABC transmembrane transporter protein. Length = 669 Score = 21.0 bits (42), Expect = 8.8 Identities = 9/11 (81%), Positives = 10/11 (90%) Frame = -1 Query: 423 ELLAVLNSSGA 391 ELLA+L SSGA Sbjct: 105 ELLAILGSSGA 115 >AF422804-1|AAL56571.1| 669|Tribolium castaneum ABC transmembrane transporter white protein. Length = 669 Score = 21.0 bits (42), Expect = 8.8 Identities = 9/11 (81%), Positives = 10/11 (90%) Frame = -1 Query: 423 ELLAVLNSSGA 391 ELLA+L SSGA Sbjct: 105 ELLAILGSSGA 115 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 145,220 Number of Sequences: 336 Number of extensions: 2860 Number of successful extensions: 7 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 16760905 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -