BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P01_F_D22 (653 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY661557-1|AAT74557.1| 411|Apis mellifera yellow-f-like protein... 25 0.48 AJ968562-1|CAI91546.1| 998|Apis mellifera protein ( Apis mellif... 24 1.1 AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. 23 1.9 >AY661557-1|AAT74557.1| 411|Apis mellifera yellow-f-like protein protein. Length = 411 Score = 25.4 bits (53), Expect = 0.48 Identities = 14/66 (21%), Positives = 28/66 (42%) Frame = +1 Query: 427 VDSVLDVVRKEAESCDCLQGFQXXXXXXXXXXXXXXXXXXXKIXEXYPDRIMNTYSVVPS 606 +DS+++++R ++CD L G I + D+I+ Y + S Sbjct: 106 IDSIINIIRVRVDACDRLWGVDTGVDDILGNNTVIHQPRII-IIDLKTDKILRIYPLKSS 164 Query: 607 PKVSDT 624 + SD+ Sbjct: 165 DQTSDS 170 >AJ968562-1|CAI91546.1| 998|Apis mellifera protein ( Apis mellifera ORF for hypotheticalprotein. ). Length = 998 Score = 24.2 bits (50), Expect = 1.1 Identities = 12/27 (44%), Positives = 17/27 (62%) Frame = -3 Query: 156 LPELSSDLVAALTSLDMYDFPHFVLFM 76 L E + +L AL+S++ F HFVL M Sbjct: 870 LVEFALELKKALSSINEQSFNHFVLKM 896 >AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. Length = 1598 Score = 23.4 bits (48), Expect = 1.9 Identities = 12/37 (32%), Positives = 19/37 (51%), Gaps = 1/37 (2%) Frame = -3 Query: 387 VAGAGLSEDEVVRTEDLSERSRADR-VHGAGLQVDED 280 ++ AG +++ R +RS +R VH G Q D D Sbjct: 1403 ISRAGSRDEDSTRDSTKLDRSSREREVHNGGQQEDRD 1439 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 168,662 Number of Sequences: 438 Number of extensions: 3300 Number of successful extensions: 6 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 19804986 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -