BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P01_F_D18 (511 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF000953-1|AAB96576.1| 433|Anopheles gambiae carboxypeptidase A... 23 6.0 AF543192-1|AAN40409.1| 636|Anopheles gambiae amino acid transpo... 23 7.9 >AF000953-1|AAB96576.1| 433|Anopheles gambiae carboxypeptidase A protein. Length = 433 Score = 23.0 bits (47), Expect = 6.0 Identities = 13/40 (32%), Positives = 20/40 (50%), Gaps = 1/40 (2%) Frame = +2 Query: 260 HQNLPSCF-STRKSXINEYGKKYLIPSHIPVIYPRNFQAI 376 HQ+L +T KS YG +Y + I IYP + ++ Sbjct: 332 HQDLNEIAEATVKSLAKRYGTQYKYGNVIDAIYPASGSSV 371 >AF543192-1|AAN40409.1| 636|Anopheles gambiae amino acid transporter Ag_AAT8 protein. Length = 636 Score = 22.6 bits (46), Expect = 7.9 Identities = 11/28 (39%), Positives = 17/28 (60%) Frame = +2 Query: 56 FKLLSKCISNLCFLLFTILGISNVEAST 139 F++L + S L FL+ +LGI + A T Sbjct: 418 FEVLPQAFSVLFFLMLFVLGIGSNVAMT 445 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 437,728 Number of Sequences: 2352 Number of extensions: 7279 Number of successful extensions: 11 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 46091631 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -