BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P01_F_D17 (654 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U28928-7|AAA68339.1| 665|Caenorhabditis elegans Peroxisomal mem... 28 6.7 U80843-9|AAB37969.1| 392|Caenorhabditis elegans Hypothetical pr... 27 8.8 >U28928-7|AAA68339.1| 665|Caenorhabditis elegans Peroxisomal membrane protein relatedprotein 1 protein. Length = 665 Score = 27.9 bits (59), Expect = 6.7 Identities = 11/29 (37%), Positives = 19/29 (65%) Frame = +2 Query: 563 DNCIMSIHINPVKKLLYRICXEMNATNFS 649 D C ++ ++ V+ +YR+C EMN T F+ Sbjct: 601 DECTSAVSVD-VEGAMYRLCREMNITLFT 628 >U80843-9|AAB37969.1| 392|Caenorhabditis elegans Hypothetical protein C32B5.14 protein. Length = 392 Score = 27.5 bits (58), Expect = 8.8 Identities = 16/54 (29%), Positives = 27/54 (50%) Frame = -3 Query: 220 INNRSRTRRLHLFIQHKNIKFERNCLKIGIL*SQNQYTTHVKICNATTFQLKIC 59 + N RL LF+ +I++ + + + + H+ + N TTFQLKIC Sbjct: 16 LKNMDSGMRLQLFVMFPSIQYLEKLFPLHVKYLTIK-SDHITV-NRTTFQLKIC 67 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,876,584 Number of Sequences: 27780 Number of extensions: 269368 Number of successful extensions: 707 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 687 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 707 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1455289764 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -