BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P01_F_D10 (654 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_43236| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.9 SB_12151| Best HMM Match : AAA_5 (HMM E-Value=0.00042) 29 4.4 SB_50513| Best HMM Match : Lig_chan (HMM E-Value=0.0083) 28 7.6 >SB_43236| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 226 Score = 29.9 bits (64), Expect = 1.9 Identities = 12/30 (40%), Positives = 19/30 (63%) Frame = +2 Query: 275 FDHCCLCLQPFDDPYCDADGNVFELQAIID 364 FD C L LQP +P DG +++ +AI++ Sbjct: 43 FDCCSLTLQPCREPVITPDGFLYDKEAILE 72 >SB_12151| Best HMM Match : AAA_5 (HMM E-Value=0.00042) Length = 4607 Score = 28.7 bits (61), Expect = 4.4 Identities = 17/49 (34%), Positives = 22/49 (44%) Frame = +2 Query: 209 TLYGGKRSGTATEEDTTFKRLPFDHCCLCLQPFDDPYCDADGNVFELQA 355 T+Y R+ TA E T+ PF CC + D DAD F+ A Sbjct: 4527 TVYRTHRNSTAQAERRTWGNKPFSRCCARVS-IDWRKIDADKGEFDSSA 4574 >SB_50513| Best HMM Match : Lig_chan (HMM E-Value=0.0083) Length = 417 Score = 27.9 bits (59), Expect = 7.6 Identities = 14/57 (24%), Positives = 29/57 (50%) Frame = +2 Query: 422 LIKLNFFKNAEDAYHCPVLFKPFTKNSHIVAIRTSGNVYSYEAVEQLNIKGKNWXDL 592 +I N+F+ +D+ C ++ F K H+V T + + + E++ G+ W D+ Sbjct: 32 MIVNNYFQ--QDSSSCSLIVYIFVKIGHLVNNETRASKITMDTEEKIFWNGEYWGDI 86 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,286,198 Number of Sequences: 59808 Number of extensions: 319950 Number of successful extensions: 787 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 750 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 787 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1669334250 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -