BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P01_F_D09 (502 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AC087079-6|AAK27864.1| 111|Caenorhabditis elegans Ribosomal pro... 80 1e-15 U89307-1|AAB48625.1| 111|Caenorhabditis elegans ribosomal prote... 76 1e-14 >AC087079-6|AAK27864.1| 111|Caenorhabditis elegans Ribosomal protein, acidic protein 1 protein. Length = 111 Score = 79.8 bits (188), Expect = 1e-15 Identities = 34/48 (70%), Positives = 44/48 (91%) Frame = +3 Query: 123 DDDVAVTGEKISTILKAAAVXVEPYWPGLFAKALEGINVRDLITNIGS 266 DD+VA+TGEKI+T+LKAA V EPYWPGLFAKALEG++V++LIT++ S Sbjct: 18 DDEVAITGEKIATLLKAANVEFEPYWPGLFAKALEGVDVKNLITSVSS 65 Score = 27.5 bits (58), Expect = 5.8 Identities = 12/16 (75%), Positives = 13/16 (81%) Frame = +2 Query: 71 MVSKAELACVYSALIL 118 M S ELACVY+ALIL Sbjct: 1 MASNQELACVYAALIL 16 >U89307-1|AAB48625.1| 111|Caenorhabditis elegans ribosomal protein P1 homolog protein. Length = 111 Score = 76.2 bits (179), Expect = 1e-14 Identities = 33/48 (68%), Positives = 43/48 (89%) Frame = +3 Query: 123 DDDVAVTGEKISTILKAAAVXVEPYWPGLFAKALEGINVRDLITNIGS 266 DD+VA+TGEKI+T+LKAA V EP WPGLFAKALEG++V++LIT++ S Sbjct: 18 DDEVAITGEKIATLLKAANVEFEPNWPGLFAKALEGVDVKNLITSVSS 65 Score = 27.5 bits (58), Expect = 5.8 Identities = 12/16 (75%), Positives = 13/16 (81%) Frame = +2 Query: 71 MVSKAELACVYSALIL 118 M S ELACVY+ALIL Sbjct: 1 MASNQELACVYAALIL 16 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,715,890 Number of Sequences: 27780 Number of extensions: 146678 Number of successful extensions: 329 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 319 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 329 length of database: 12,740,198 effective HSP length: 76 effective length of database: 10,628,918 effective search space used: 956602620 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -