BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P01_F_D08 (617 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY578805-1|AAT07310.1| 753|Anopheles gambiae medea protein. 27 0.37 >AY578805-1|AAT07310.1| 753|Anopheles gambiae medea protein. Length = 753 Score = 27.5 bits (58), Expect = 0.37 Identities = 19/64 (29%), Positives = 29/64 (45%), Gaps = 2/64 (3%) Frame = +3 Query: 168 AANMPTIGTVGQGAIQYVNNPMQSPQLQNTSIQGSPSQHSPMGTQS--QVAKVGQGGAGD 341 ++++P +G G VNN +++P Q PSQ +QS Q+ G G Sbjct: 257 SSSLPLSSVIG-GPPGMVNNGLRAPPSSQQQPQQQPSQQPQPSSQSNAQLTNGGSNGLLG 315 Query: 342 QSSQ 353 SSQ Sbjct: 316 SSSQ 319 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 520,630 Number of Sequences: 2352 Number of extensions: 7913 Number of successful extensions: 14 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 14 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 14 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 60553008 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -