BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P01_F_D04 (651 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value EF592537-1|ABQ95983.1| 593|Tribolium castaneum beta-N-acetylglu... 26 0.23 AY800247-1|AAV66724.1| 790|Tribolium castaneum pangolin protein. 23 2.2 AY800246-1|AAV66723.1| 682|Tribolium castaneum pangolin protein. 23 2.2 DQ855501-1|ABH88188.1| 146|Tribolium castaneum chemosensory pro... 21 6.7 DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 21 6.7 >EF592537-1|ABQ95983.1| 593|Tribolium castaneum beta-N-acetylglucosaminidase NAG2 protein. Length = 593 Score = 26.2 bits (55), Expect = 0.23 Identities = 11/38 (28%), Positives = 19/38 (50%) Frame = +3 Query: 258 LVQICKMAQVYPHPAPEGCTSASSESAPSDQPIYPDTG 371 L + ++ VYP+ C + E++ SD P +P G Sbjct: 182 LETLSQLMDVYPNNDGTKCLVVTDEASISDAPFFPHRG 219 >AY800247-1|AAV66724.1| 790|Tribolium castaneum pangolin protein. Length = 790 Score = 23.0 bits (47), Expect = 2.2 Identities = 12/30 (40%), Positives = 16/30 (53%), Gaps = 2/30 (6%) Frame = +3 Query: 288 YPHP--APEGCTSASSESAPSDQPIYPDTG 371 YP+P +PE A+S PS P+ P G Sbjct: 172 YPYPILSPEMSQVAASWHTPSMYPLSPGAG 201 >AY800246-1|AAV66723.1| 682|Tribolium castaneum pangolin protein. Length = 682 Score = 23.0 bits (47), Expect = 2.2 Identities = 12/30 (40%), Positives = 16/30 (53%), Gaps = 2/30 (6%) Frame = +3 Query: 288 YPHP--APEGCTSASSESAPSDQPIYPDTG 371 YP+P +PE A+S PS P+ P G Sbjct: 64 YPYPILSPEMSQVAASWHTPSMYPLSPGAG 93 >DQ855501-1|ABH88188.1| 146|Tribolium castaneum chemosensory protein 15 protein. Length = 146 Score = 21.4 bits (43), Expect = 6.7 Identities = 8/17 (47%), Positives = 11/17 (64%) Frame = +3 Query: 495 TKEAQHHPIRHKHSHQA 545 TK HH I+ +H HQ+ Sbjct: 101 TKFNPHHEIKLQHLHQS 117 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 21.4 bits (43), Expect = 6.7 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = +3 Query: 321 ASSESAPSDQPIYPD 365 ASS APS P+ PD Sbjct: 2288 ASSTMAPSTTPMVPD 2302 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 134,465 Number of Sequences: 336 Number of extensions: 2533 Number of successful extensions: 6 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 16760905 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -