BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P01_F_D02 (652 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 04_04_0465 + 25427065-25427113,25428099-25428227,25428387-254284... 29 3.2 02_05_0004 - 24880826-24882033,24882106-24882276,24882360-24883203 29 4.2 01_06_1374 + 36740860-36741365,36742529-36743003,36743084-36743890 29 4.2 09_06_0216 + 21627238-21627834 28 5.6 04_04_0339 - 24513699-24516827 28 5.6 02_01_0598 + 4440018-4440070,4440627-4440693,4440794-4440926,444... 28 5.6 02_01_0014 - 87215-87280,87358-87495,87593-87721,87801-87869,879... 28 5.6 12_02_1279 + 27510605-27513301 28 7.4 02_01_0301 + 2011707-2015423,2016982-2017182,2017670-2017786,201... 28 7.4 07_03_1506 - 27161056-27161454 27 9.8 05_01_0091 + 602481-602721,602819-602901,603431-603560,604188-60... 27 9.8 03_05_0865 - 28365430-28367640 27 9.8 >04_04_0465 + 25427065-25427113,25428099-25428227,25428387-25428479, 25428681-25428953,25429037-25429288,25429735-25430118, 25430243-25430483,25431986-25432736 Length = 723 Score = 29.1 bits (62), Expect = 3.2 Identities = 19/72 (26%), Positives = 37/72 (51%) Frame = +2 Query: 398 IISGFVLCYSFKQSCFMFPATCGKRGKEAASRCWSWILTVPSLKTSASRVVKSYLSTIST 577 ++ F +C +K F G+ +A+R + S+ +S + S++STI+T Sbjct: 232 VLMSFGICIIWKYKGFEKSRGTGRVSNSSATRKTGMRSSFSSMTSSTA----SFVSTIAT 287 Query: 578 RTCTLKTFTLSD 613 T+KTF++S+ Sbjct: 288 CPPTVKTFSISE 299 >02_05_0004 - 24880826-24882033,24882106-24882276,24882360-24883203 Length = 740 Score = 28.7 bits (61), Expect = 4.2 Identities = 20/57 (35%), Positives = 28/57 (49%), Gaps = 4/57 (7%) Frame = -2 Query: 387 FNFVLSFDMWADAGLHVILSD--AADKSVRDGESRVYPAVR--VHNGERDFINDAVN 229 + FVLS + AD L V + D SVR G+ R+Y A+ +NG +N N Sbjct: 33 WTFVLSCNRSADGRLRVYNYEIEVVDVSVRRGQLRIYSAINPWCYNGSTSAMNGQSN 89 >01_06_1374 + 36740860-36741365,36742529-36743003,36743084-36743890 Length = 595 Score = 28.7 bits (61), Expect = 4.2 Identities = 14/34 (41%), Positives = 18/34 (52%), Gaps = 1/34 (2%) Frame = -2 Query: 384 NFVLSFDMWA-DAGLHVILSDAADKSVRDGESRV 286 N LSFD W D LH+++ D R+ SRV Sbjct: 12 NRALSFDDWVPDEALHLVMGHVEDPRDREAASRV 45 >09_06_0216 + 21627238-21627834 Length = 198 Score = 28.3 bits (60), Expect = 5.6 Identities = 14/30 (46%), Positives = 19/30 (63%) Frame = +2 Query: 509 LTVPSLKTSASRVVKSYLSTISTRTCTLKT 598 LTVPS+ T + V SY++T +T T T T Sbjct: 160 LTVPSVDTYNTSTVTSYVATDNTSTITSST 189 >04_04_0339 - 24513699-24516827 Length = 1042 Score = 28.3 bits (60), Expect = 5.6 Identities = 16/53 (30%), Positives = 27/53 (50%), Gaps = 1/53 (1%) Frame = +2 Query: 497 WSWILTV-PSLKTSASRVVKSYLSTISTRTCTLKTFTLSDSLYVKFSTLST*W 652 W ++ V S K+ + +V S + + T T +L+ +TL L + S L T W Sbjct: 272 WKLLIEVLESAKSGSKMIVTSRVPDVVTMTNSLRPYTLKRLLPIDSSNLLTQW 324 >02_01_0598 + 4440018-4440070,4440627-4440693,4440794-4440926, 4441075-4441120,4442470-4442521,4442601-4442753, 4443338-4443457,4443549-4443714,4443822-4443934, 4444049-4444120,4444992-4445213,4445270-4445317, 4445639-4445697,4445809-4445887,4445982-4446119, 4446327-4446551,4446643-4447430,4447548-4447723, 4447911-4448169,4448646-4448707,4451055-4451212, 4451618-4451743,4452197-4452260,4452386-4452494, 4452607-4452760,4453055-4453178,4453257-4453333, 4453442-4453494,4453673-4453727,4453833-4454021 Length = 1379 Score = 28.3 bits (60), Expect = 5.6 Identities = 18/63 (28%), Positives = 26/63 (41%) Frame = +2 Query: 266 WTRTAGYTLLSPSRTDLSAASERITCNPASAHMSKDKTKLNITNIISGFVLCYSFKQSCF 445 W+ Y L + +L A +RI HM + LN+T I FKQ+ F Sbjct: 1210 WSFEEAYNLSRDHKPELEAERDRIVKAGGFIHMGRINGSLNLTRAIGDM----EFKQNKF 1265 Query: 446 MFP 454 + P Sbjct: 1266 LPP 1268 >02_01_0014 - 87215-87280,87358-87495,87593-87721,87801-87869, 87962-88042,88133-88237,88338-88568,88665-90197, 90660-90752,91477-92887,93184-93305,93479-93718, 94521-94682,94770-94937,95025-95141,95266-95376, 95919-96506 Length = 1787 Score = 28.3 bits (60), Expect = 5.6 Identities = 20/63 (31%), Positives = 30/63 (47%) Frame = +2 Query: 377 TKLNITNIISGFVLCYSFKQSCFMFPATCGKRGKEAASRCWSWILTVPSLKTSASRVVKS 556 T+L+ TN +S F S + + +CG GKE S +P L+ A R KS Sbjct: 704 TELSKTNGVSTFEFIRSGVVAALLDYLSCGTFGKERVSEA-----NLPKLRQQALRRYKS 758 Query: 557 YLS 565 ++S Sbjct: 759 FIS 761 >12_02_1279 + 27510605-27513301 Length = 898 Score = 27.9 bits (59), Expect = 7.4 Identities = 12/24 (50%), Positives = 16/24 (66%) Frame = +2 Query: 251 SRSPLWTRTAGYTLLSPSRTDLSA 322 SR+P+WT TAG T+L L+A Sbjct: 91 SRTPVWTATAGTTILQSIVLSLTA 114 >02_01_0301 + 2011707-2015423,2016982-2017182,2017670-2017786, 2018030-2018122 Length = 1375 Score = 27.9 bits (59), Expect = 7.4 Identities = 13/34 (38%), Positives = 19/34 (55%) Frame = +2 Query: 518 PSLKTSASRVVKSYLSTISTRTCTLKTFTLSDSL 619 PSL+ S R++ S L ++ R CT+ L D L Sbjct: 1014 PSLELSDRRILPSQLKEVTVRGCTIHDGFLHDDL 1047 >07_03_1506 - 27161056-27161454 Length = 132 Score = 27.5 bits (58), Expect = 9.8 Identities = 15/44 (34%), Positives = 22/44 (50%) Frame = -2 Query: 312 SVRDGESRVYPAVRVHNGERDFINDAVNRVTDVLSRRDEKRERD 181 +VRD E P V NG D +++ + +V RR+E R D Sbjct: 49 AVRDDEDDGAPTVGGRNGGADEVDEDAAKPMEVTPRREEVRGDD 92 >05_01_0091 + 602481-602721,602819-602901,603431-603560,604188-604267, 604353-604442,605019-605143,605702-605762,605839-605889, 605976-606053,606136-606241,606333-606478,607054-607176 Length = 437 Score = 27.5 bits (58), Expect = 9.8 Identities = 13/34 (38%), Positives = 19/34 (55%) Frame = -3 Query: 137 LSMHTESSLRSPFTEPKTSNMAGARRVGRGREYG 36 LS++ S R+P T +SN+ G V R +E G Sbjct: 46 LSLYASSLPRAPTTPSSSSNLVGLTLVRRAKEKG 79 >03_05_0865 - 28365430-28367640 Length = 736 Score = 27.5 bits (58), Expect = 9.8 Identities = 18/51 (35%), Positives = 24/51 (47%) Frame = -2 Query: 327 DAADKSVRDGESRVYPAVRVHNGERDFINDAVNRVTDVLSRRDEKRERDQD 175 D++ RD R R + +RD D R D SRRD R+RD+D Sbjct: 62 DSSSSHHRDSSDRDRDRDRDRDRDRDRDRDRERRRDDD-SRRDRDRDRDRD 111 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,415,377 Number of Sequences: 37544 Number of extensions: 399230 Number of successful extensions: 1241 Number of sequences better than 10.0: 12 Number of HSP's better than 10.0 without gapping: 1204 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1241 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1620349964 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -