BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P01_F_D01 (654 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC19G7.05c |bgs1|cps1, drc1|1,3-beta-glucan synthase catalytic... 26 5.5 SPBC146.14c |sec26|SPBC337.01c|coatomer beta subunit |Schizosacc... 26 5.5 >SPBC19G7.05c |bgs1|cps1, drc1|1,3-beta-glucan synthase catalytic subunit Bgs1|Schizosaccharomyces pombe|chr 2|||Manual Length = 1729 Score = 25.8 bits (54), Expect = 5.5 Identities = 13/39 (33%), Positives = 22/39 (56%), Gaps = 1/39 (2%) Frame = +2 Query: 50 VSFFTFTLNFGL-PT*N*KSRTK*VYVIXIRH*SYLCID 163 ++FF F L L P +S+T VY+ + H ++C+D Sbjct: 1493 IAFFFFCLGIMLRPILGDRSKTYGVYLAGVAHFLFVCVD 1531 >SPBC146.14c |sec26|SPBC337.01c|coatomer beta subunit |Schizosaccharomyces pombe|chr 2|||Manual Length = 940 Score = 25.8 bits (54), Expect = 5.5 Identities = 20/70 (28%), Positives = 29/70 (41%) Frame = +1 Query: 115 ISIRNXNKTLKLFMY*LSRPVSNGRSEPDDGAXRRNDGTAGLMGCLXEKAHQPLKEAKLA 294 +S RN L F L++ SNG +E DDG RR T + C H + Sbjct: 342 VSSRNVEDILNHFQKELTK--SNGETEKDDG--RRRALTKAIHSCAINFPHTAATAIQYL 397 Query: 295 SRTLAKFYNK 324 ++ F +K Sbjct: 398 LSHISDFQSK 407 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,188,417 Number of Sequences: 5004 Number of extensions: 35180 Number of successful extensions: 86 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 84 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 86 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 295793106 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -