BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P01_F_D01 (654 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U40935-7|AAA81691.3| 338|Caenorhabditis elegans C.elegans homeo... 95 4e-20 U01303-1|AAC46471.1| 338|Caenorhabditis elegans Ceh-20 protein. 95 4e-20 Z68114-11|CAA92154.1| 329|Caenorhabditis elegans Hypothetical p... 36 0.019 >U40935-7|AAA81691.3| 338|Caenorhabditis elegans C.elegans homeobox protein 20 protein. Length = 338 Score = 95.1 bits (226), Expect = 4e-20 Identities = 44/82 (53%), Positives = 58/82 (70%), Gaps = 1/82 (1%) Frame = +3 Query: 300 DIGEILQQIMNITDQSLHEAQ-ARKHTLNCHTMKPALFSVLCEIKEKTVLSLXNTQEEEP 476 ++ E+L ++ I +Q+L + A+K L CH M+ ALF VLCE KEKTVL++ N +E P Sbjct: 8 NLSELLDAVLKINEQTLDDNDSAKKQELQCHPMRQALFDVLCETKEKTVLTVRNQVDETP 67 Query: 477 PDPXLMRLDNMLIAEGVXGPXK 542 DP LMRLDNML+AEGV GP K Sbjct: 68 EDPQLMRLDNMLVAEGVAGPDK 89 >U01303-1|AAC46471.1| 338|Caenorhabditis elegans Ceh-20 protein. Length = 338 Score = 95.1 bits (226), Expect = 4e-20 Identities = 44/82 (53%), Positives = 58/82 (70%), Gaps = 1/82 (1%) Frame = +3 Query: 300 DIGEILQQIMNITDQSLHEAQ-ARKHTLNCHTMKPALFSVLCEIKEKTVLSLXNTQEEEP 476 ++ E+L ++ I +Q+L + A+K L CH M+ ALF VLCE KEKTVL++ N +E P Sbjct: 8 NLSELLDAVLKINEQTLDDNDSAKKQELQCHPMRQALFDVLCETKEKTVLTVRNQVDETP 67 Query: 477 PDPXLMRLDNMLIAEGVXGPXK 542 DP LMRLDNML+AEGV GP K Sbjct: 68 EDPQLMRLDNMLVAEGVAGPDK 89 >Z68114-11|CAA92154.1| 329|Caenorhabditis elegans Hypothetical protein F17A2.5 protein. Length = 329 Score = 36.3 bits (80), Expect = 0.019 Identities = 28/82 (34%), Positives = 44/82 (53%), Gaps = 2/82 (2%) Frame = +3 Query: 297 QDIGEILQQIMNITDQSL-HEAQAR-KHTLNCHTMKPALFSVLCEIKEKTVLSLXNTQEE 470 + I ++L +++ ITD ++ +EA + K + + A+ VL E K K LS ++ Sbjct: 6 KSIMDLLSEVVKITDMTMDNEAVNKLKPQIKINPFYRAVQDVLVEQKSKIDLSTKMMKDL 65 Query: 471 EPPDPXLMRLDNMLIAEGVXGP 536 E + RLD ML AEGV GP Sbjct: 66 EAQEND-ERLDTMLKAEGVAGP 86 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,346,675 Number of Sequences: 27780 Number of extensions: 204610 Number of successful extensions: 447 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 441 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 446 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1455289764 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -