BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P01_F_D01 (654 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ667194-1|ABG75746.1| 391|Apis mellifera cys-loop ligand-gated... 23 2.6 AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter... 21 7.9 AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter... 21 7.9 >DQ667194-1|ABG75746.1| 391|Apis mellifera cys-loop ligand-gated ion channel subunit protein. Length = 391 Score = 23.0 bits (47), Expect = 2.6 Identities = 12/39 (30%), Positives = 19/39 (48%), Gaps = 1/39 (2%) Frame = +1 Query: 64 VYFE-FWFTNLKLKITYKISIRNXNKTLKLFMY*LSRPV 177 +Y E F + KL++ + N LKL Y + +PV Sbjct: 132 IYIESFSYHKQKLRLRWGTGAVTVNPELKLLQYDIGKPV 170 >AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 593 Score = 21.4 bits (43), Expect = 7.9 Identities = 5/10 (50%), Positives = 10/10 (100%) Frame = +2 Query: 20 ILYVWYSTSG 49 ++Y+W++TSG Sbjct: 547 MIYIWFTTSG 556 >AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 646 Score = 21.4 bits (43), Expect = 7.9 Identities = 5/10 (50%), Positives = 10/10 (100%) Frame = +2 Query: 20 ILYVWYSTSG 49 ++Y+W++TSG Sbjct: 600 MIYIWFTTSG 609 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 148,541 Number of Sequences: 438 Number of extensions: 2569 Number of successful extensions: 3 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 19804986 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -