Bombyx BLAST Result against bee

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fe100P01_F_D01
         (654 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

DQ667194-1|ABG75746.1|  391|Apis mellifera cys-loop ligand-gated...    23   2.6  
AY395072-1|AAQ96728.1|  593|Apis mellifera GABA neurotransmitter...    21   7.9  
AY395071-1|AAQ96727.1|  646|Apis mellifera GABA neurotransmitter...    21   7.9  

>DQ667194-1|ABG75746.1|  391|Apis mellifera cys-loop ligand-gated
           ion channel subunit protein.
          Length = 391

 Score = 23.0 bits (47), Expect = 2.6
 Identities = 12/39 (30%), Positives = 19/39 (48%), Gaps = 1/39 (2%)
 Frame = +1

Query: 64  VYFE-FWFTNLKLKITYKISIRNXNKTLKLFMY*LSRPV 177
           +Y E F +   KL++ +       N  LKL  Y + +PV
Sbjct: 132 IYIESFSYHKQKLRLRWGTGAVTVNPELKLLQYDIGKPV 170


>AY395072-1|AAQ96728.1|  593|Apis mellifera GABA neurotransmitter
           transporter-1B protein.
          Length = 593

 Score = 21.4 bits (43), Expect = 7.9
 Identities = 5/10 (50%), Positives = 10/10 (100%)
 Frame = +2

Query: 20  ILYVWYSTSG 49
           ++Y+W++TSG
Sbjct: 547 MIYIWFTTSG 556


>AY395071-1|AAQ96727.1|  646|Apis mellifera GABA neurotransmitter
           transporter-1B protein.
          Length = 646

 Score = 21.4 bits (43), Expect = 7.9
 Identities = 5/10 (50%), Positives = 10/10 (100%)
 Frame = +2

Query: 20  ILYVWYSTSG 49
           ++Y+W++TSG
Sbjct: 600 MIYIWFTTSG 609


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 148,541
Number of Sequences: 438
Number of extensions: 2569
Number of successful extensions: 3
Number of sequences better than 10.0: 3
Number of HSP's better than 10.0 without gapping: 3
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 3
length of database: 146,343
effective HSP length: 55
effective length of database: 122,253
effective search space used: 19804986
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)