BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P01_F_C24 (652 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 01_06_1015 + 33819203-33821827 31 0.60 11_04_0001 + 11984639-11984875,11984989-11985278,11985361-119857... 28 7.4 >01_06_1015 + 33819203-33821827 Length = 874 Score = 31.5 bits (68), Expect = 0.60 Identities = 13/32 (40%), Positives = 20/32 (62%) Frame = +3 Query: 219 LWYVQCEAILAPXKLSDEARYNLVVTKLGKDV 314 +W + ++ P L+ E YNL+ TK+GKDV Sbjct: 56 MWPHGPDTVIMPQPLTYEESYNLLCTKIGKDV 87 >11_04_0001 + 11984639-11984875,11984989-11985278,11985361-11985719, 11985797-11985984,11986058-11986247,11986497-11986631, 11986694-11986947 Length = 550 Score = 27.9 bits (59), Expect = 7.4 Identities = 15/45 (33%), Positives = 21/45 (46%) Frame = +3 Query: 348 PDEKKFDTLKERLLKIYEXSXMRQFQKLLXEMELGDQKPSQLLRR 482 PD F +KER+ KI+ + + + LL E L P RR Sbjct: 50 PDSLDFMVMKERMYKIFSNAIVVCYSHLLPEFALMKSDPPITQRR 94 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,908,759 Number of Sequences: 37544 Number of extensions: 264757 Number of successful extensions: 669 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 658 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 669 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1620349964 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -