BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P01_F_C20 (637 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value DQ219483-1|ABB29887.1| 961|Anopheles gambiae cryptochrome 2 pro... 25 2.0 AF387862-2|AAL56548.1| 942|Anopheles gambiae pol polyprotein pr... 25 2.0 >DQ219483-1|ABB29887.1| 961|Anopheles gambiae cryptochrome 2 protein. Length = 961 Score = 25.0 bits (52), Expect = 2.0 Identities = 8/39 (20%), Positives = 20/39 (51%) Frame = +1 Query: 277 LTFQKITXIVTAVDSQPMFDGGVLINVLGRLKCDEXPPH 393 LT+ + I+ ++D+ P + + ++V+G + H Sbjct: 149 LTYHQFQAIIASMDAPPQPEAAITLDVIGNANTPQYDDH 187 >AF387862-2|AAL56548.1| 942|Anopheles gambiae pol polyprotein protein. Length = 942 Score = 25.0 bits (52), Expect = 2.0 Identities = 13/38 (34%), Positives = 24/38 (63%), Gaps = 1/38 (2%) Frame = -1 Query: 205 STLYILTRFAR*AXIIEQCVILLHKTF-TDCIVLRIER 95 +T+Y L R + A +IE+ V ++H F + IV+R ++ Sbjct: 107 TTVYFLKRKSEAAEVIEEYVTMVHNRFGRNPIVIRSDQ 144 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 637,600 Number of Sequences: 2352 Number of extensions: 11625 Number of successful extensions: 18 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 18 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 18 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 62305095 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -