BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P01_F_C18 (653 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_9343| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.3 SB_12646| Best HMM Match : SSrecog (HMM E-Value=0) 29 4.4 SB_11434| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.8 SB_16873| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.6 >SB_9343| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 786 Score = 29.1 bits (62), Expect = 3.3 Identities = 13/72 (18%), Positives = 37/72 (51%) Frame = +3 Query: 432 KRXAMLVREVXRLDNQIASMRTELXSLXXLQKETHLRRVKQKKSGRPRPERAPKKSAPSG 611 ++ + L +++ + Q++ + E + +K+ +++K++ +P+P + PK+ A Sbjct: 464 EKLSQLQQQLISVHEQLSKLTGESVLVTKTKKKPE-KKIKKEPPAKPKPVKPPKQQATKT 522 Query: 612 DVVDAPEQSYAS 647 + P + AS Sbjct: 523 PKAEKPPKKSAS 534 >SB_12646| Best HMM Match : SSrecog (HMM E-Value=0) Length = 783 Score = 28.7 bits (61), Expect = 4.4 Identities = 18/82 (21%), Positives = 40/82 (48%), Gaps = 5/82 (6%) Frame = +3 Query: 417 QMYAEKRXAMLVREVXRLDNQIASMRTELXSL---XXLQKETHLRRVKQKKSGRP--RPE 581 Q +K + V EV ++ ++ T+ ++K+ +++R+K+ + + E Sbjct: 558 QEIKDKNPGISVTEVSKVAGEMWKNLTDKSKWEEKAAIEKQKYVQRMKEYNENKKNDKEE 617 Query: 582 RAPKKSAPSGDVVDAPEQSYAS 647 +PKK +PS AP++ +S Sbjct: 618 SSPKKKSPSKKASKAPKEEKSS 639 >SB_11434| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 866 Score = 28.3 bits (60), Expect = 5.8 Identities = 17/58 (29%), Positives = 29/58 (50%), Gaps = 2/58 (3%) Frame = -2 Query: 307 MQDTSSNNFISGLHCVXYCEI--KVSLKLTIYRTLSLIXIALSEKIQVKAMFFFLPGK 140 M T+ N ++ +H Y + + KL IY T +L I+ + + ++FF PGK Sbjct: 659 MAVTAVNRYLQVVHANYYRRLFTRKRTKLFIYGTWALASISPIQYLASGELYFFNPGK 716 >SB_16873| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 110 Score = 27.9 bits (59), Expect = 7.6 Identities = 12/40 (30%), Positives = 20/40 (50%) Frame = +3 Query: 471 DNQIASMRTELXSLXXLQKETHLRRVKQKKSGRPRPERAP 590 +N+I T L + +K R +K+ SG +PE+ P Sbjct: 59 ENEIRPRTTTLERILARRKSITNRNIKEASSGEKKPEKFP 98 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,354,171 Number of Sequences: 59808 Number of extensions: 274720 Number of successful extensions: 717 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 661 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 717 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1669334250 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -