BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P01_F_C15 (525 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_49262| Best HMM Match : Virus_P-coat (HMM E-Value=1.8) 29 2.3 SB_1952| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.5 >SB_49262| Best HMM Match : Virus_P-coat (HMM E-Value=1.8) Length = 586 Score = 29.1 bits (62), Expect = 2.3 Identities = 11/21 (52%), Positives = 15/21 (71%) Frame = -2 Query: 371 WSIYRRFAIEGLNSRSQSGKQ 309 W++Y + E N+RSQSGKQ Sbjct: 116 WAVYGLLSFEDRNTRSQSGKQ 136 >SB_1952| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 351 Score = 27.1 bits (57), Expect = 9.5 Identities = 19/61 (31%), Positives = 30/61 (49%) Frame = -1 Query: 393 LCTLYVLMVYLSTVRDRRVKFTITIR*TMETLNNTKRLIYIYVITYXSVAVFKNYSRIFV 214 +CT V YL+ +VKF +R +NTK I + ++T S+ Y+ +FV Sbjct: 168 ICTFIVFFCYLAIWI--KVKFFTPLRNARRDASNTKLTITLSLVTLASLICSLPYN-LFV 224 Query: 213 I 211 I Sbjct: 225 I 225 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,079,278 Number of Sequences: 59808 Number of extensions: 195962 Number of successful extensions: 254 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 248 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 254 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 1184975377 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -