BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P01_F_C13 (347 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 05_04_0118 - 18162934-18162982,18163246-18163357,18163583-18163622 27 3.1 09_04_0269 + 16265191-16265472,16265574-16266149 27 4.0 05_01_0046 + 320600-320631,320694-320733,320871-320957,321282-32... 27 4.0 12_01_0357 + 2720860-2721066,2721169-2721384,2721481-2723608,272... 27 5.3 01_07_0358 + 43039613-43039677,43039742-43039807,43039918-43040029 26 9.3 >05_04_0118 - 18162934-18162982,18163246-18163357,18163583-18163622 Length = 66 Score = 27.5 bits (58), Expect = 3.1 Identities = 12/35 (34%), Positives = 18/35 (51%), Gaps = 6/35 (17%) Frame = +3 Query: 222 SGRKHSRCCTSILRKFSGR------QHCVTVDCCC 308 +G+K RCC S R+ + R + C+ CCC Sbjct: 24 AGKKKGRCCGSSCRRSTKRGETSFIEGCIAALCCC 58 >09_04_0269 + 16265191-16265472,16265574-16266149 Length = 285 Score = 27.1 bits (57), Expect = 4.0 Identities = 11/20 (55%), Positives = 14/20 (70%) Frame = -2 Query: 184 MESTXPQCHILQHRRPRLPL 125 M T P C +L++ RPRLPL Sbjct: 157 MARTGPLCLLLENPRPRLPL 176 >05_01_0046 + 320600-320631,320694-320733,320871-320957,321282-321378, 321532-321823,321850-321990,322285-322390 Length = 264 Score = 27.1 bits (57), Expect = 4.0 Identities = 16/55 (29%), Positives = 22/55 (40%) Frame = +3 Query: 78 ARRXQKLKEHGASSCISGKRGRRCCNIWHWGXVDSISGSRARFQLXGNSGRKHSR 242 A++ + E S G G + W+W D SGS + FQ S SR Sbjct: 87 AQKWKNFDEDDCSDTPYGNFGGKRSFTWYWPGEDDESGSPSGFQWRDESQSNKSR 141 >12_01_0357 + 2720860-2721066,2721169-2721384,2721481-2723608, 2723699-2724124,2724242-2724546,2724660-2724823, 2724899-2724980 Length = 1175 Score = 26.6 bits (56), Expect = 5.3 Identities = 11/22 (50%), Positives = 15/22 (68%) Frame = +3 Query: 189 GSRARFQLXGNSGRKHSRCCTS 254 GSRA F+ NS +KHS+ C + Sbjct: 865 GSRALFEGGFNSSQKHSKSCAA 886 >01_07_0358 + 43039613-43039677,43039742-43039807,43039918-43040029 Length = 80 Score = 25.8 bits (54), Expect = 9.3 Identities = 7/13 (53%), Positives = 9/13 (69%) Frame = -3 Query: 255 CLCSSGCASCRYS 217 C C +GC C+YS Sbjct: 14 CQCGNGCGGCKYS 26 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,394,754 Number of Sequences: 37544 Number of extensions: 135241 Number of successful extensions: 286 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 285 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 286 length of database: 14,793,348 effective HSP length: 73 effective length of database: 12,052,636 effective search space used: 506210712 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -