BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P01_F_C13 (347 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g15840.1 68417.m02409 expressed protein 27 2.6 At4g27370.1 68417.m03929 myosin family protein contains Pfam pro... 26 7.9 >At4g15840.1 68417.m02409 expressed protein Length = 660 Score = 27.5 bits (58), Expect = 2.6 Identities = 13/31 (41%), Positives = 16/31 (51%) Frame = +3 Query: 183 ISGSRARFQLXGNSGRKHSRCCTSILRKFSG 275 +SGS FQ NS R CTS++ K G Sbjct: 115 VSGSNLVFQQSSNSQTNFGRPCTSVVDKTEG 145 >At4g27370.1 68417.m03929 myosin family protein contains Pfam profiles: PF00063 myosin head (motor domain), PF00612 IQ calmodulin-binding motif Length = 1126 Score = 25.8 bits (54), Expect = 7.9 Identities = 11/18 (61%), Positives = 14/18 (77%), Gaps = 1/18 (5%) Frame = +3 Query: 93 KLKEH-GASSCISGKRGR 143 KLK+H A+SC G+RGR Sbjct: 610 KLKQHLNANSCFKGERGR 627 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 6,349,750 Number of Sequences: 28952 Number of extensions: 98424 Number of successful extensions: 204 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 203 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 204 length of database: 12,070,560 effective HSP length: 72 effective length of database: 9,986,016 effective search space used: 429398688 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -