BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P01_F_C11 (639 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value EF625899-1|ABR45906.1| 1010|Apis mellifera high Glx storage prot... 23 3.3 DQ026034-1|AAY87893.1| 569|Apis mellifera nicotinic acetylcholi... 22 5.8 DQ026033-1|AAY87892.1| 569|Apis mellifera nicotinic acetylcholi... 22 5.8 >EF625899-1|ABR45906.1| 1010|Apis mellifera high Glx storage protein protein. Length = 1010 Score = 22.6 bits (46), Expect = 3.3 Identities = 11/31 (35%), Positives = 16/31 (51%) Frame = -1 Query: 591 SWPRVVRAGVSESGFGFVASSCVNAVYWRSV 499 +W GV+ G G VAS +A W+S+ Sbjct: 907 TWSNSQVQGVAVPGSGIVASGQQHAGGWQSI 937 >DQ026034-1|AAY87893.1| 569|Apis mellifera nicotinic acetylcholine receptor alpha4subunit protein. Length = 569 Score = 21.8 bits (44), Expect = 5.8 Identities = 11/38 (28%), Positives = 18/38 (47%) Frame = +2 Query: 416 PLXGVQKYIQATDLSEASQEAVEEKLRATDRQ*TAFTH 529 PL + + + DLS + + +EE R AF+H Sbjct: 440 PLPPLPLHTECEDLSVSGEAGIEEVKSPVLRSPPAFSH 477 >DQ026033-1|AAY87892.1| 569|Apis mellifera nicotinic acetylcholine receptor alpha4subunit protein. Length = 569 Score = 21.8 bits (44), Expect = 5.8 Identities = 11/38 (28%), Positives = 18/38 (47%) Frame = +2 Query: 416 PLXGVQKYIQATDLSEASQEAVEEKLRATDRQ*TAFTH 529 PL + + + DLS + + +EE R AF+H Sbjct: 440 PLPPLPLHTECEDLSVSGEAGIEEVKSPVLRSPPAFSH 477 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 151,094 Number of Sequences: 438 Number of extensions: 2863 Number of successful extensions: 5 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 19193721 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -